Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3963442..3964136 | Replicon | chromosome |
| Accession | NZ_CP122679 | ||
| Organism | Escherichia coli strain ETEC4069 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | A0A0D8WHS4 |
| Locus tag | QDW53_RS19575 | Protein ID | WP_001521903.1 |
| Coordinates | 3963442..3963840 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | QDW53_RS19580 | Protein ID | WP_000554755.1 |
| Coordinates | 3963843..3964136 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW53_RS19545 (3958576) | 3958576..3960033 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| QDW53_RS19550 (3960042) | 3960042..3960323 | + | 282 | WP_077881290.1 | hypothetical protein | - |
| QDW53_RS19555 (3960340) | 3960340..3960849 | - | 510 | WP_063085380.1 | metal-dependent hydrolase | - |
| QDW53_RS19560 (3960911) | 3960911..3961525 | - | 615 | WP_000602129.1 | peptide chain release factor H | - |
| QDW53_RS19565 (3961522) | 3961522..3962661 | - | 1140 | WP_063085369.1 | RNA ligase RtcB family protein | - |
| QDW53_RS19570 (3962980) | 3962980..3963432 | - | 453 | WP_001059858.1 | GNAT family N-acetyltransferase | - |
| QDW53_RS19575 (3963442) | 3963442..3963840 | - | 399 | WP_001521903.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QDW53_RS19580 (3963843) | 3963843..3964136 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QDW53_RS19585 (3964188) | 3964188..3965243 | - | 1056 | WP_192297422.1 | DNA polymerase IV | - |
| QDW53_RS19590 (3965314) | 3965314..3966099 | - | 786 | WP_074150236.1 | putative lateral flagellar export/assembly protein LafU | - |
| QDW53_RS19595 (3966071) | 3966071..3967783 | + | 1713 | Protein_3839 | flagellar biosynthesis protein FlhA | - |
| QDW53_RS19600 (3967888) | 3967888..3968166 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| QDW53_RS19605 (3968159) | 3968159..3968515 | + | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15471.88 Da Isoelectric Point: 8.0949
>T277668 WP_001521903.1 NZ_CP122679:c3963840-3963442 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D8WHS4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |