Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3963442..3964136 Replicon chromosome
Accession NZ_CP122679
Organism Escherichia coli strain ETEC4069

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag QDW53_RS19575 Protein ID WP_001521903.1
Coordinates 3963442..3963840 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag QDW53_RS19580 Protein ID WP_000554755.1
Coordinates 3963843..3964136 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW53_RS19545 (3958576) 3958576..3960033 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
QDW53_RS19550 (3960042) 3960042..3960323 + 282 WP_077881290.1 hypothetical protein -
QDW53_RS19555 (3960340) 3960340..3960849 - 510 WP_063085380.1 metal-dependent hydrolase -
QDW53_RS19560 (3960911) 3960911..3961525 - 615 WP_000602129.1 peptide chain release factor H -
QDW53_RS19565 (3961522) 3961522..3962661 - 1140 WP_063085369.1 RNA ligase RtcB family protein -
QDW53_RS19570 (3962980) 3962980..3963432 - 453 WP_001059858.1 GNAT family N-acetyltransferase -
QDW53_RS19575 (3963442) 3963442..3963840 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDW53_RS19580 (3963843) 3963843..3964136 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDW53_RS19585 (3964188) 3964188..3965243 - 1056 WP_192297422.1 DNA polymerase IV -
QDW53_RS19590 (3965314) 3965314..3966099 - 786 WP_074150236.1 putative lateral flagellar export/assembly protein LafU -
QDW53_RS19595 (3966071) 3966071..3967783 + 1713 Protein_3839 flagellar biosynthesis protein FlhA -
QDW53_RS19600 (3967888) 3967888..3968166 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
QDW53_RS19605 (3968159) 3968159..3968515 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T277668 WP_001521903.1 NZ_CP122679:c3963840-3963442 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT277668 WP_000554755.1 NZ_CP122679:c3964136-3963843 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References