Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 616341..617140 | Replicon | chromosome |
Accession | NZ_CP122679 | ||
Organism | Escherichia coli strain ETEC4069 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A3A6SBL4 |
Locus tag | QDW53_RS02970 | Protein ID | WP_062875446.1 |
Coordinates | 616341..616805 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QDW53_RS02975 | Protein ID | WP_001307405.1 |
Coordinates | 616805..617140 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW53_RS02940 (611342) | 611342..611776 | - | 435 | WP_063086247.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QDW53_RS02945 (611794) | 611794..612672 | - | 879 | WP_192297513.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QDW53_RS02950 (612662) | 612662..613441 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QDW53_RS02955 (613452) | 613452..613925 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QDW53_RS02960 (613948) | 613948..615228 | - | 1281 | WP_063086249.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QDW53_RS02965 (615477) | 615477..616286 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
QDW53_RS02970 (616341) | 616341..616805 | - | 465 | WP_062875446.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QDW53_RS02975 (616805) | 616805..617140 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QDW53_RS02980 (617289) | 617289..618860 | - | 1572 | WP_001273756.1 | galactarate dehydratase | - |
QDW53_RS02985 (619235) | 619235..620569 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
QDW53_RS02990 (620585) | 620585..621360 | + | 776 | Protein_584 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 616341..627633 | 11292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17844.22 Da Isoelectric Point: 9.4942
>T277652 WP_062875446.1 NZ_CP122679:c616805-616341 [Escherichia coli]
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A6SBL4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |