Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 94658..94922 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP122678 | ||
| Organism | Escherichia coli strain ETEC4070 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | QDW57_RS25670 | Protein ID | WP_001331364.1 |
| Coordinates | 94658..94810 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 94865..94922 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW57_RS25640 (89935) | 89935..92103 | + | 2169 | WP_001774191.1 | DotA/TraY family protein | - |
| QDW57_RS25645 (92177) | 92177..92827 | + | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QDW57_RS25650 (92899) | 92899..93108 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| QDW57_RS25655 (93500) | 93500..93676 | + | 177 | WP_001054897.1 | hypothetical protein | - |
| QDW57_RS25660 (93741) | 93741..93836 | - | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| QDW57_RS25665 (94335) | 94335..94586 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| QDW57_RS25670 (94658) | 94658..94810 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| - (94865) | 94865..94922 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (94865) | 94865..94922 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (94865) | 94865..94922 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (94865) | 94865..94922 | + | 58 | NuclAT_0 | - | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B | - | 1..95101 | 95101 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T277648 WP_001331364.1 NZ_CP122678:c94810-94658 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT277648 NZ_CP122678:94865-94922 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|