Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4860782..4861384 | Replicon | chromosome |
Accession | NZ_CP122676 | ||
Organism | Escherichia coli strain ETEC4070 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QDW57_RS23870 | Protein ID | WP_000897305.1 |
Coordinates | 4861073..4861384 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDW57_RS23865 | Protein ID | WP_000356395.1 |
Coordinates | 4860782..4861072 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW57_RS23830 (4856406) | 4856406..4857308 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QDW57_RS23835 (4857305) | 4857305..4857940 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QDW57_RS23840 (4857937) | 4857937..4858866 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QDW57_RS23845 (4859048) | 4859048..4859290 | - | 243 | WP_001306649.1 | protein YiiF | - |
QDW57_RS23850 (4859509) | 4859509..4859727 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
QDW57_RS23855 (4860146) | 4860146..4860424 | - | 279 | WP_001306650.1 | hypothetical protein | - |
QDW57_RS23860 (4860476) | 4860476..4860697 | - | 222 | WP_001550354.1 | hypothetical protein | - |
QDW57_RS23865 (4860782) | 4860782..4861072 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
QDW57_RS23870 (4861073) | 4861073..4861384 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QDW57_RS23875 (4861613) | 4861613..4862521 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
QDW57_RS23880 (4862690) | 4862690..4863604 | - | 915 | WP_225102955.1 | transposase | - |
QDW57_RS23885 (4863617) | 4863617..4864504 | - | 888 | Protein_4668 | hypothetical protein | - |
QDW57_RS23890 (4864920) | 4864920..4865861 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QDW57_RS23895 (4865906) | 4865906..4866343 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277647 WP_000897305.1 NZ_CP122676:c4861384-4861073 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|