Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4003541..4004235 Replicon chromosome
Accession NZ_CP122676
Organism Escherichia coli strain ETEC4070

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag QDW57_RS19715 Protein ID WP_001521903.1
Coordinates 4003541..4003939 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag QDW57_RS19720 Protein ID WP_000554755.1
Coordinates 4003942..4004235 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW57_RS19685 (3998675) 3998675..4000132 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
QDW57_RS19690 (4000141) 4000141..4000422 + 282 WP_077881290.1 hypothetical protein -
QDW57_RS19695 (4000439) 4000439..4000948 - 510 WP_063085380.1 metal-dependent hydrolase -
QDW57_RS19700 (4001010) 4001010..4001624 - 615 WP_000602129.1 peptide chain release factor H -
QDW57_RS19705 (4001621) 4001621..4002760 - 1140 WP_063085369.1 RNA ligase RtcB family protein -
QDW57_RS19710 (4003079) 4003079..4003531 - 453 WP_001059858.1 GNAT family N-acetyltransferase -
QDW57_RS19715 (4003541) 4003541..4003939 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDW57_RS19720 (4003942) 4003942..4004235 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDW57_RS19725 (4004287) 4004287..4005342 - 1056 WP_192297422.1 DNA polymerase IV -
QDW57_RS19730 (4005413) 4005413..4006198 - 786 WP_074150236.1 putative lateral flagellar export/assembly protein LafU -
QDW57_RS19735 (4006170) 4006170..4007882 + 1713 Protein_3865 flagellar biosynthesis protein FlhA -
QDW57_RS19740 (4007987) 4007987..4008265 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
QDW57_RS19745 (4008258) 4008258..4008614 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T277643 WP_001521903.1 NZ_CP122676:c4003939-4003541 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT277643 WP_000554755.1 NZ_CP122676:c4004235-4003942 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References