Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 94661..94925 | Replicon | plasmid unnamed1 |
Accession | NZ_CP122674 | ||
Organism | Escherichia coli strain ETEC4071 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | QDW56_RS25365 | Protein ID | WP_001331364.1 |
Coordinates | 94661..94813 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 94868..94925 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW56_RS25335 (89938) | 89938..92106 | + | 2169 | WP_001774191.1 | DotA/TraY family protein | - |
QDW56_RS25340 (92180) | 92180..92830 | + | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
QDW56_RS25345 (92902) | 92902..93111 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
QDW56_RS25350 (93503) | 93503..93679 | + | 177 | WP_001054897.1 | hypothetical protein | - |
QDW56_RS25355 (93744) | 93744..93839 | - | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
QDW56_RS25360 (94338) | 94338..94589 | + | 252 | WP_001291964.1 | hypothetical protein | - |
QDW56_RS25365 (94661) | 94661..94813 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
- (94868) | 94868..94925 | + | 58 | NuclAT_0 | - | Antitoxin |
- (94868) | 94868..94925 | + | 58 | NuclAT_0 | - | Antitoxin |
- (94868) | 94868..94925 | + | 58 | NuclAT_0 | - | Antitoxin |
- (94868) | 94868..94925 | + | 58 | NuclAT_0 | - | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B | - | 1..95104 | 95104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T277624 WP_001331364.1 NZ_CP122674:c94813-94661 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT277624 NZ_CP122674:94868-94925 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|