Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4860786..4861388 | Replicon | chromosome |
| Accession | NZ_CP122673 | ||
| Organism | Escherichia coli strain ETEC4071 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | QDW56_RS23875 | Protein ID | WP_000897305.1 |
| Coordinates | 4861077..4861388 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QDW56_RS23870 | Protein ID | WP_000356395.1 |
| Coordinates | 4860786..4861076 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW56_RS23835 (4856409) | 4856409..4857311 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QDW56_RS23840 (4857308) | 4857308..4857943 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QDW56_RS23845 (4857940) | 4857940..4858869 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| QDW56_RS23850 (4859051) | 4859051..4859293 | - | 243 | WP_001306649.1 | protein YiiF | - |
| QDW56_RS23855 (4859512) | 4859512..4859730 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| QDW56_RS23860 (4860149) | 4860149..4860427 | - | 279 | WP_001306650.1 | hypothetical protein | - |
| QDW56_RS23865 (4860489) | 4860489..4860701 | - | 213 | WP_000197769.1 | hypothetical protein | - |
| QDW56_RS23870 (4860786) | 4860786..4861076 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| QDW56_RS23875 (4861077) | 4861077..4861388 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| QDW56_RS23880 (4861617) | 4861617..4862525 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
| QDW56_RS23885 (4862694) | 4862694..4863608 | - | 915 | WP_225102955.1 | transposase | - |
| QDW56_RS23890 (4863621) | 4863621..4864508 | - | 888 | Protein_4669 | hypothetical protein | - |
| QDW56_RS23895 (4864924) | 4864924..4865865 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QDW56_RS23900 (4865910) | 4865910..4866347 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277623 WP_000897305.1 NZ_CP122673:c4861388-4861077 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|