Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1138412..1139139 | Replicon | chromosome |
Accession | NZ_CP122673 | ||
Organism | Escherichia coli strain ETEC4071 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0YLE2 |
Locus tag | QDW56_RS05485 | Protein ID | WP_000547555.1 |
Coordinates | 1138412..1138723 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDW56_RS05490 | Protein ID | WP_000126294.1 |
Coordinates | 1138720..1139139 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW56_RS05460 (1134347) | 1134347..1136056 | + | 1710 | WP_063086195.1 | formate hydrogenlyase subunit HycE | - |
QDW56_RS05465 (1136066) | 1136066..1136608 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
QDW56_RS05470 (1136608) | 1136608..1137375 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
QDW56_RS05475 (1137372) | 1137372..1137782 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
QDW56_RS05480 (1137775) | 1137775..1138245 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
QDW56_RS05485 (1138412) | 1138412..1138723 | + | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
QDW56_RS05490 (1138720) | 1138720..1139139 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
QDW56_RS05495 (1139218) | 1139218..1140642 | - | 1425 | WP_063086210.1 | 6-phospho-beta-glucosidase AscB | - |
QDW56_RS05500 (1140651) | 1140651..1142108 | - | 1458 | WP_001107888.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
QDW56_RS05505 (1142368) | 1142368..1143378 | + | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
QDW56_RS05510 (1143527) | 1143527..1144054 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T277606 WP_000547555.1 NZ_CP122673:1138412-1138723 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT277606 WP_000126294.1 NZ_CP122673:1138720-1139139 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|