Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 617893..618692 | Replicon | chromosome |
| Accession | NZ_CP122673 | ||
| Organism | Escherichia coli strain ETEC4071 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A3A6SBL4 |
| Locus tag | QDW56_RS02985 | Protein ID | WP_062875446.1 |
| Coordinates | 617893..618357 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | QDW56_RS02990 | Protein ID | WP_001307405.1 |
| Coordinates | 618357..618692 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW56_RS02955 (612894) | 612894..613328 | - | 435 | WP_063086247.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QDW56_RS02960 (613346) | 613346..614224 | - | 879 | WP_192297513.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QDW56_RS02965 (614214) | 614214..614993 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QDW56_RS02970 (615004) | 615004..615477 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QDW56_RS02975 (615500) | 615500..616780 | - | 1281 | WP_063086249.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QDW56_RS02980 (617029) | 617029..617838 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
| QDW56_RS02985 (617893) | 617893..618357 | - | 465 | WP_062875446.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QDW56_RS02990 (618357) | 618357..618692 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QDW56_RS02995 (618841) | 618841..620412 | - | 1572 | WP_001273756.1 | galactarate dehydratase | - |
| QDW56_RS03000 (620787) | 620787..622121 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QDW56_RS03005 (622137) | 622137..622912 | + | 776 | Protein_587 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 617893..629184 | 11291 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17844.22 Da Isoelectric Point: 9.4942
>T277603 WP_062875446.1 NZ_CP122673:c618357-617893 [Escherichia coli]
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3A6SBL4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |