Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3745286..3745980 | Replicon | chromosome |
| Accession | NZ_CP122660 | ||
| Organism | Escherichia coli strain ETEC4073 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | QDY26_RS18515 | Protein ID | WP_001263489.1 |
| Coordinates | 3745286..3745684 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | QDY26_RS18520 | Protein ID | WP_000554758.1 |
| Coordinates | 3745687..3745980 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3740874) | 3740874..3740954 | - | 81 | NuclAT_11 | - | - |
| - (3740874) | 3740874..3740954 | - | 81 | NuclAT_11 | - | - |
| - (3740874) | 3740874..3740954 | - | 81 | NuclAT_11 | - | - |
| - (3740874) | 3740874..3740954 | - | 81 | NuclAT_11 | - | - |
| QDY26_RS18490 (3741550) | 3741550..3742008 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| QDY26_RS18495 (3742269) | 3742269..3743726 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| QDY26_RS18500 (3743783) | 3743783..3744304 | - | 522 | Protein_3618 | peptide chain release factor H | - |
| QDY26_RS18505 (3744300) | 3744300..3744506 | - | 207 | Protein_3619 | RtcB family protein | - |
| QDY26_RS18510 (3744824) | 3744824..3745276 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| QDY26_RS18515 (3745286) | 3745286..3745684 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QDY26_RS18520 (3745687) | 3745687..3745980 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QDY26_RS18525 (3746032) | 3746032..3747087 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| QDY26_RS18530 (3747158) | 3747158..3747943 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| QDY26_RS18535 (3747915) | 3747915..3749627 | + | 1713 | Protein_3625 | flagellar biosynthesis protein FlhA | - |
| QDY26_RS18540 (3749851) | 3749851..3750348 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T277590 WP_001263489.1 NZ_CP122660:c3745684-3745286 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |