Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3827725..3828419 Replicon chromosome
Accession NZ_CP122655
Organism Escherichia coli strain ETEC4074

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag QDW60_RS19115 Protein ID WP_001263493.1
Coordinates 3827725..3828123 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag QDW60_RS19120 Protein ID WP_000554757.1
Coordinates 3828126..3828419 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3823385) 3823385..3823465 - 81 NuclAT_9 - -
- (3823385) 3823385..3823465 - 81 NuclAT_9 - -
- (3823385) 3823385..3823465 - 81 NuclAT_9 - -
- (3823385) 3823385..3823465 - 81 NuclAT_9 - -
QDW60_RS19085 (3822725) 3822725..3823969 - 1245 WP_000189541.1 esterase FrsA -
QDW60_RS19090 (3824061) 3824061..3824519 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
QDW60_RS19095 (3824780) 3824780..3826237 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
QDW60_RS19100 (3826294) 3826294..3826815 - 522 Protein_3740 peptide chain release factor H -
QDW60_RS19105 (3826814) 3826814..3827017 - 204 Protein_3741 RtcB family protein -
QDW60_RS19110 (3827263) 3827263..3827715 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
QDW60_RS19115 (3827725) 3827725..3828123 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDW60_RS19120 (3828126) 3828126..3828419 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDW60_RS19125 (3828471) 3828471..3829526 - 1056 WP_001226164.1 DNA polymerase IV -
QDW60_RS19130 (3829597) 3829597..3830520 - 924 WP_001232547.1 putative lateral flagellar export/assembly protein LafU -
QDW60_RS19135 (3830523) 3830523..3831386 - 864 WP_001169518.1 flagellar motor stator protein MotA -
QDW60_RS19140 (3831399) 3831399..3832115 - 717 WP_000938723.1 FliA/WhiG family RNA polymerase sigma factor -
QDW60_RS19145 (3832135) 3832135..3832602 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE 3779351..3828419 49068


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T277567 WP_001263493.1 NZ_CP122655:c3828123-3827725 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT277567 WP_000554757.1 NZ_CP122655:c3828419-3828126 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References