Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2725454..2725825 | Replicon | chromosome |
| Accession | NZ_CP122655 | ||
| Organism | Escherichia coli strain ETEC4074 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | - |
| Locus tag | QDW60_RS13725 | Protein ID | WP_032083637.1 |
| Coordinates | 2725454..2725648 (+) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2725647..2725825 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW60_RS13705 (2720556) | 2720556..2720732 | + | 177 | WP_000241145.1 | YdaE family protein | - |
| QDW60_RS13710 (2720806) | 2720806..2721081 | + | 276 | WP_000632298.1 | hypothetical protein | - |
| QDW60_RS13715 (2721183) | 2721183..2724326 | + | 3144 | WP_032083635.1 | exodeoxyribonuclease VIII | - |
| QDW60_RS13720 (2724338) | 2724338..2725390 | + | 1053 | WP_032083636.1 | RecT family recombinase | - |
| QDW60_RS13725 (2725454) | 2725454..2725648 | + | 195 | WP_032083637.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| - (2725647) | 2725647..2725825 | - | 179 | NuclAT_8 | - | Antitoxin |
| - (2725647) | 2725647..2725825 | - | 179 | NuclAT_8 | - | Antitoxin |
| - (2725647) | 2725647..2725825 | - | 179 | NuclAT_8 | - | Antitoxin |
| - (2725647) | 2725647..2725825 | - | 179 | NuclAT_8 | - | Antitoxin |
| QDW60_RS13730 (2725641) | 2725641..2725829 | + | 189 | WP_001602382.1 | DUF1187 family protein | - |
| QDW60_RS13735 (2725929) | 2725929..2726144 | + | 216 | WP_000079604.1 | excisionase XisR | - |
| QDW60_RS13740 (2726146) | 2726146..2727381 | + | 1236 | WP_072014650.1 | site-specific integrase | - |
| QDW60_RS13745 (2727433) | 2727433..2728368 | + | 936 | WP_001157377.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| QDW60_RS13750 (2728497) | 2728497..2729870 | - | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
| QDW60_RS13755 (2729900) | 2729900..2730073 | - | 174 | WP_001296046.1 | protein YnaL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2678586..2731331 | 52745 | |
| - | inside | Prophage | - | - | 2678586..2734640 | 56054 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7107.02 Da Isoelectric Point: 9.5240
>T277563 WP_032083637.1 NZ_CP122655:2725454-2725648 [Escherichia coli]
MRYEKVKPYPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYEKVKPYPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT277563 NZ_CP122655:c2725825-2725647 [Escherichia coli]
GAAGATTGAAGTTTCTCGCAATTAAAATTTATAAGTTTTACTTTCTGCTCTCTGGAAACACCAGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTGTTGAGTACCTTGTCCAGCTGGTAGGAGAACCTCCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAAGATTGAAGTTTCTCGCAATTAAAATTTATAAGTTTTACTTTCTGCTCTCTGGAAACACCAGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTGTTGAGTACCTTGTCCAGCTGGTAGGAGAACCTCCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|