Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 755562..756255 | Replicon | chromosome |
| Accession | NZ_CP122655 | ||
| Organism | Escherichia coli strain ETEC4074 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | QDW60_RS03695 | Protein ID | WP_000415584.1 |
| Coordinates | 755562..755858 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | QDW60_RS03700 | Protein ID | WP_000650107.1 |
| Coordinates | 755860..756255 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW60_RS03660 (751118) | 751118..751282 | + | 165 | Protein_718 | DUF2645 domain-containing protein | - |
| QDW60_RS03670 (752051) | 752051..752227 | + | 177 | Protein_720 | DUF2645 domain-containing protein | - |
| QDW60_RS03675 (752273) | 752273..753622 | - | 1350 | WP_001618857.1 | quorum sensing histidine kinase QseC | - |
| QDW60_RS03680 (753619) | 753619..754278 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| QDW60_RS03685 (754430) | 754430..754822 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| QDW60_RS03690 (754875) | 754875..755357 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| QDW60_RS03695 (755562) | 755562..755858 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| QDW60_RS03700 (755860) | 755860..756255 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| QDW60_RS03705 (756388) | 756388..757995 | + | 1608 | WP_032083699.1 | ABC transporter substrate-binding protein | - |
| QDW60_RS03710 (758133) | 758133..760391 | + | 2259 | WP_001618856.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 734339..760391 | 26052 | |
| - | inside | Prophage | - | - | 737076..760391 | 23315 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T277553 WP_000415584.1 NZ_CP122655:755562-755858 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT277553 WP_000650107.1 NZ_CP122655:755860-756255 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|