Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 9343..9607 Replicon plasmid unnamed2
Accession NZ_CP122654
Organism Escherichia coli strain ETEC4075

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag QDW61_RS24935 Protein ID WP_001387489.1
Coordinates 9455..9607 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 9343..9405 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW61_RS24920 (4582) 4582..6873 - 2292 WP_021497839.1 F-type conjugative transfer protein TrbC -
QDW61_RS24925 (6866) 6866..7936 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
QDW61_RS24930 (7955) 7955..9163 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (9343) 9343..9405 - 63 NuclAT_0 - Antitoxin
- (9343) 9343..9405 - 63 NuclAT_0 - Antitoxin
- (9343) 9343..9405 - 63 NuclAT_0 - Antitoxin
- (9343) 9343..9405 - 63 NuclAT_0 - Antitoxin
QDW61_RS24935 (9455) 9455..9607 + 153 WP_001387489.1 Hok/Gef family protein Toxin
QDW61_RS24940 (9679) 9679..9930 - 252 WP_001291964.1 hypothetical protein -
QDW61_RS24945 (10429) 10429..10524 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
QDW61_RS24950 (10589) 10589..10765 - 177 WP_001054898.1 hypothetical protein -
QDW61_RS24955 (11165) 11165..11374 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
QDW61_RS24960 (11446) 11446..12096 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
QDW61_RS24965 (12170) 12170..14338 - 2169 WP_052938719.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul1 / qacE / ant(3'')-Ia / dfrA1 / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B - 1..109222 109222


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T277545 WP_001387489.1 NZ_CP122654:9455-9607 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT277545 NZ_CP122654:c9405-9343 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References