Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 9343..9607 | Replicon | plasmid unnamed2 |
Accession | NZ_CP122654 | ||
Organism | Escherichia coli strain ETEC4075 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | QDW61_RS24935 | Protein ID | WP_001387489.1 |
Coordinates | 9455..9607 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 9343..9405 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW61_RS24920 (4582) | 4582..6873 | - | 2292 | WP_021497839.1 | F-type conjugative transfer protein TrbC | - |
QDW61_RS24925 (6866) | 6866..7936 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
QDW61_RS24930 (7955) | 7955..9163 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
- (9343) | 9343..9405 | - | 63 | NuclAT_0 | - | Antitoxin |
- (9343) | 9343..9405 | - | 63 | NuclAT_0 | - | Antitoxin |
- (9343) | 9343..9405 | - | 63 | NuclAT_0 | - | Antitoxin |
- (9343) | 9343..9405 | - | 63 | NuclAT_0 | - | Antitoxin |
QDW61_RS24935 (9455) | 9455..9607 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
QDW61_RS24940 (9679) | 9679..9930 | - | 252 | WP_001291964.1 | hypothetical protein | - |
QDW61_RS24945 (10429) | 10429..10524 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
QDW61_RS24950 (10589) | 10589..10765 | - | 177 | WP_001054898.1 | hypothetical protein | - |
QDW61_RS24955 (11165) | 11165..11374 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
QDW61_RS24960 (11446) | 11446..12096 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
QDW61_RS24965 (12170) | 12170..14338 | - | 2169 | WP_052938719.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul1 / qacE / ant(3'')-Ia / dfrA1 / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B | - | 1..109222 | 109222 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T277545 WP_001387489.1 NZ_CP122654:9455-9607 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT277545 NZ_CP122654:c9405-9343 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|