Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4818992..4819594 | Replicon | chromosome |
Accession | NZ_CP122652 | ||
Organism | Escherichia coli strain ETEC4075 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QDW61_RS23620 | Protein ID | WP_000897305.1 |
Coordinates | 4819283..4819594 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDW61_RS23615 | Protein ID | WP_000356395.1 |
Coordinates | 4818992..4819282 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW61_RS23580 (4814615) | 4814615..4815517 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QDW61_RS23585 (4815514) | 4815514..4816149 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QDW61_RS23590 (4816146) | 4816146..4817075 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QDW61_RS23595 (4817257) | 4817257..4817499 | - | 243 | WP_001306649.1 | protein YiiF | - |
QDW61_RS23600 (4817718) | 4817718..4817936 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
QDW61_RS23605 (4818355) | 4818355..4818633 | - | 279 | WP_001306650.1 | hypothetical protein | - |
QDW61_RS23610 (4818695) | 4818695..4818907 | - | 213 | WP_000197769.1 | hypothetical protein | - |
QDW61_RS23615 (4818992) | 4818992..4819282 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
QDW61_RS23620 (4819283) | 4819283..4819594 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QDW61_RS23625 (4819823) | 4819823..4820731 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
QDW61_RS23630 (4820900) | 4820900..4821814 | - | 915 | WP_225102955.1 | transposase | - |
QDW61_RS23635 (4821827) | 4821827..4822714 | - | 888 | Protein_4618 | hypothetical protein | - |
QDW61_RS23640 (4823130) | 4823130..4824071 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QDW61_RS23645 (4824116) | 4824116..4824553 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277544 WP_000897305.1 NZ_CP122652:c4819594-4819283 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|