Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3986372..3987066 Replicon chromosome
Accession NZ_CP122652
Organism Escherichia coli strain ETEC4075

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag QDW61_RS19630 Protein ID WP_001521903.1
Coordinates 3986372..3986770 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag QDW61_RS19635 Protein ID WP_000554755.1
Coordinates 3986773..3987066 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW61_RS19600 (3981506) 3981506..3982963 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
QDW61_RS19605 (3982972) 3982972..3983253 + 282 WP_077881290.1 hypothetical protein -
QDW61_RS19610 (3983270) 3983270..3983779 - 510 WP_063085380.1 metal-dependent hydrolase -
QDW61_RS19615 (3983841) 3983841..3984455 - 615 WP_000602129.1 peptide chain release factor H -
QDW61_RS19620 (3984452) 3984452..3985591 - 1140 WP_063085369.1 RNA ligase RtcB family protein -
QDW61_RS19625 (3985910) 3985910..3986362 - 453 WP_001059858.1 GNAT family N-acetyltransferase -
QDW61_RS19630 (3986372) 3986372..3986770 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDW61_RS19635 (3986773) 3986773..3987066 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDW61_RS19640 (3987118) 3987118..3988173 - 1056 WP_001226166.1 DNA polymerase IV -
QDW61_RS19645 (3988244) 3988244..3989029 - 786 WP_074150236.1 putative lateral flagellar export/assembly protein LafU -
QDW61_RS19650 (3989001) 3989001..3990713 + 1713 Protein_3848 flagellar biosynthesis protein FlhA -
QDW61_RS19655 (3990818) 3990818..3991096 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
QDW61_RS19660 (3991089) 3991089..3991445 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T277541 WP_001521903.1 NZ_CP122652:c3986770-3986372 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT277541 WP_000554755.1 NZ_CP122652:c3987066-3986773 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References