Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2726713..2727084 | Replicon | chromosome |
| Accession | NZ_CP122652 | ||
| Organism | Escherichia coli strain ETEC4075 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A839BBC2 |
| Locus tag | QDW61_RS13435 | Protein ID | WP_021500490.1 |
| Coordinates | 2726713..2726907 (+) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2726906..2727084 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW61_RS13415 (2721843) | 2721843..2722013 | + | 171 | WP_065336296.1 | YdaE family protein | - |
| QDW61_RS13420 (2722088) | 2722088..2722363 | + | 276 | WP_001372690.1 | hypothetical protein | - |
| QDW61_RS13425 (2722463) | 2722463..2725585 | + | 3123 | WP_120145591.1 | exodeoxyribonuclease VIII | - |
| QDW61_RS13430 (2725597) | 2725597..2726649 | + | 1053 | WP_001004412.1 | RecT family recombinase | - |
| QDW61_RS13435 (2726713) | 2726713..2726907 | + | 195 | WP_021500490.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| - (2726906) | 2726906..2727084 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2726906) | 2726906..2727084 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2726906) | 2726906..2727084 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2726906) | 2726906..2727084 | - | 179 | NuclAT_1 | - | Antitoxin |
| QDW61_RS13440 (2726900) | 2726900..2727088 | + | 189 | WP_001372676.1 | DUF1187 family protein | - |
| QDW61_RS13445 (2727188) | 2727188..2727403 | + | 216 | WP_000079604.1 | excisionase XisR | - |
| QDW61_RS13450 (2727405) | 2727405..2728640 | + | 1236 | WP_024168543.1 | site-specific integrase | - |
| QDW61_RS13455 (2728692) | 2728692..2729627 | + | 936 | WP_001157382.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| QDW61_RS13460 (2729756) | 2729756..2731129 | - | 1374 | WP_063085924.1 | ATP-dependent RNA helicase DbpA | - |
| QDW61_RS13465 (2731159) | 2731159..2731332 | - | 174 | WP_001296046.1 | protein YnaL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2701124..2728640 | 27516 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7046.98 Da Isoelectric Point: 9.2886
>T277534 WP_021500490.1 NZ_CP122652:2726713-2726907 [Escherichia coli]
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT277534 NZ_CP122652:c2727084-2726906 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGCTGGTAGGAGAACCACCTTCCTTTT
CAATAGTGGCGGTGATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGCTGGTAGGAGAACCACCTTCCTTTT
CAATAGTGGCGGTGATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
