Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1184820..1185547 | Replicon | chromosome |
Accession | NZ_CP122652 | ||
Organism | Escherichia coli strain ETEC4075 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0YLE2 |
Locus tag | QDW61_RS05675 | Protein ID | WP_000547555.1 |
Coordinates | 1184820..1185131 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDW61_RS05680 | Protein ID | WP_000126294.1 |
Coordinates | 1185128..1185547 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW61_RS05650 (1180755) | 1180755..1182464 | + | 1710 | WP_063086195.1 | formate hydrogenlyase subunit HycE | - |
QDW61_RS05655 (1182474) | 1182474..1183016 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
QDW61_RS05660 (1183016) | 1183016..1183783 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
QDW61_RS05665 (1183780) | 1183780..1184190 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
QDW61_RS05670 (1184183) | 1184183..1184653 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
QDW61_RS05675 (1184820) | 1184820..1185131 | + | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
QDW61_RS05680 (1185128) | 1185128..1185547 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
QDW61_RS05685 (1185626) | 1185626..1187050 | - | 1425 | WP_063086210.1 | 6-phospho-beta-glucosidase AscB | - |
QDW61_RS05690 (1187059) | 1187059..1188516 | - | 1458 | WP_001107888.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
QDW61_RS05695 (1188776) | 1188776..1189786 | + | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
QDW61_RS05700 (1189935) | 1189935..1190462 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T277526 WP_000547555.1 NZ_CP122652:1184820-1185131 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT277526 WP_000126294.1 NZ_CP122652:1185128-1185547 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|