Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 620926..621725 | Replicon | chromosome |
Accession | NZ_CP122652 | ||
Organism | Escherichia coli strain ETEC4075 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A3A6SBL4 |
Locus tag | QDW61_RS02995 | Protein ID | WP_062875446.1 |
Coordinates | 620926..621390 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QDW61_RS03000 | Protein ID | WP_001307405.1 |
Coordinates | 621390..621725 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW61_RS02965 (615927) | 615927..616361 | - | 435 | WP_063086247.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QDW61_RS02970 (616379) | 616379..617257 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QDW61_RS02975 (617247) | 617247..618026 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QDW61_RS02980 (618037) | 618037..618510 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QDW61_RS02985 (618533) | 618533..619813 | - | 1281 | WP_063086249.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QDW61_RS02990 (620062) | 620062..620871 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
QDW61_RS02995 (620926) | 620926..621390 | - | 465 | WP_062875446.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QDW61_RS03000 (621390) | 621390..621725 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QDW61_RS03005 (621874) | 621874..623445 | - | 1572 | WP_001273756.1 | galactarate dehydratase | - |
QDW61_RS03010 (623820) | 623820..625154 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
QDW61_RS03015 (625170) | 625170..625945 | + | 776 | Protein_589 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 620926..632219 | 11293 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17844.22 Da Isoelectric Point: 9.4942
>T277523 WP_062875446.1 NZ_CP122652:c621390-620926 [Escherichia coli]
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A6SBL4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |