Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4955624..4956226 | Replicon | chromosome |
| Accession | NZ_CP122648 | ||
| Organism | Escherichia coli strain ETEC4077 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | QDY56_RS24545 | Protein ID | WP_000897305.1 |
| Coordinates | 4955915..4956226 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QDY56_RS24540 | Protein ID | WP_000356395.1 |
| Coordinates | 4955624..4955914 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY56_RS24505 (4951248) | 4951248..4952150 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QDY56_RS24510 (4952147) | 4952147..4952782 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QDY56_RS24515 (4952779) | 4952779..4953708 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| QDY56_RS24520 (4953890) | 4953890..4954132 | - | 243 | WP_001306649.1 | protein YiiF | - |
| QDY56_RS24525 (4954351) | 4954351..4954569 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| QDY56_RS24530 (4954988) | 4954988..4955266 | - | 279 | WP_001306650.1 | hypothetical protein | - |
| QDY56_RS24535 (4955318) | 4955318..4955539 | - | 222 | WP_001550354.1 | hypothetical protein | - |
| QDY56_RS24540 (4955624) | 4955624..4955914 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| QDY56_RS24545 (4955915) | 4955915..4956226 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| QDY56_RS24550 (4956455) | 4956455..4957363 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
| QDY56_RS24555 (4957532) | 4957532..4958446 | - | 915 | WP_225102955.1 | transposase | - |
| QDY56_RS24560 (4958459) | 4958459..4959346 | - | 888 | Protein_4807 | hypothetical protein | - |
| QDY56_RS24565 (4959762) | 4959762..4960703 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QDY56_RS24570 (4960748) | 4960748..4961185 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277520 WP_000897305.1 NZ_CP122648:c4956226-4955915 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|