Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4040237..4040931 Replicon chromosome
Accession NZ_CP122648
Organism Escherichia coli strain ETEC4077

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag QDY56_RS19970 Protein ID WP_001521903.1
Coordinates 4040237..4040635 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag QDY56_RS19975 Protein ID WP_000554755.1
Coordinates 4040638..4040931 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY56_RS19940 (4035371) 4035371..4036828 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
QDY56_RS19945 (4036837) 4036837..4037118 + 282 WP_077881290.1 hypothetical protein -
QDY56_RS19950 (4037135) 4037135..4037644 - 510 WP_063085380.1 metal-dependent hydrolase -
QDY56_RS19955 (4037706) 4037706..4038320 - 615 WP_000602129.1 peptide chain release factor H -
QDY56_RS19960 (4038317) 4038317..4039456 - 1140 WP_063085369.1 RNA ligase RtcB family protein -
QDY56_RS19965 (4039775) 4039775..4040227 - 453 WP_001059858.1 GNAT family N-acetyltransferase -
QDY56_RS19970 (4040237) 4040237..4040635 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDY56_RS19975 (4040638) 4040638..4040931 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDY56_RS19980 (4040983) 4040983..4042038 - 1056 WP_192297422.1 DNA polymerase IV -
QDY56_RS19985 (4042109) 4042109..4042894 - 786 WP_074150236.1 putative lateral flagellar export/assembly protein LafU -
QDY56_RS19990 (4042866) 4042866..4044578 + 1713 Protein_3921 flagellar biosynthesis protein FlhA -
QDY56_RS19995 (4044683) 4044683..4044961 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
QDY56_RS20000 (4044954) 4044954..4045310 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T277515 WP_001521903.1 NZ_CP122648:c4040635-4040237 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT277515 WP_000554755.1 NZ_CP122648:c4040931-4040638 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References