Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1157423..1158150 | Replicon | chromosome |
| Accession | NZ_CP122648 | ||
| Organism | Escherichia coli strain ETEC4077 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0YLE2 |
| Locus tag | QDY56_RS05595 | Protein ID | WP_000547555.1 |
| Coordinates | 1157423..1157734 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QDY56_RS05600 | Protein ID | WP_000126294.1 |
| Coordinates | 1157731..1158150 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY56_RS05570 (1153358) | 1153358..1155067 | + | 1710 | WP_063086195.1 | formate hydrogenlyase subunit HycE | - |
| QDY56_RS05575 (1155077) | 1155077..1155619 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| QDY56_RS05580 (1155619) | 1155619..1156386 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| QDY56_RS05585 (1156383) | 1156383..1156793 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
| QDY56_RS05590 (1156786) | 1156786..1157256 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| QDY56_RS05595 (1157423) | 1157423..1157734 | + | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QDY56_RS05600 (1157731) | 1157731..1158150 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QDY56_RS05605 (1158229) | 1158229..1159653 | - | 1425 | WP_063086210.1 | 6-phospho-beta-glucosidase AscB | - |
| QDY56_RS05610 (1159662) | 1159662..1161119 | - | 1458 | WP_001107888.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| QDY56_RS05615 (1161379) | 1161379..1162389 | + | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
| QDY56_RS05620 (1162538) | 1162538..1163065 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T277502 WP_000547555.1 NZ_CP122648:1157423-1157734 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT277502 WP_000126294.1 NZ_CP122648:1157731-1158150 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|