Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 936006..936510 | Replicon | chromosome |
Accession | NC_017857 | ||
Organism | Methylophaga nitratireducenticrescens |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | Q7A_RS04470 | Protein ID | WP_202971552.1 |
Coordinates | 936006..936230 (+) | Length | 75 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | Q7A_RS04475 | Protein ID | WP_202971553.1 |
Coordinates | 936220..936510 (+) | Length | 97 a.a. |
Genomic Context
Location: 931835..932140 (306 bp)
Type: Others
Protein ID: WP_041354369.1
Type: Others
Protein ID: WP_041354369.1
Location: 932330..933082 (753 bp)
Type: Others
Protein ID: WP_014706132.1
Type: Others
Protein ID: WP_014706132.1
Location: 933315..933467 (153 bp)
Type: Others
Protein ID: WP_014706133.1
Type: Others
Protein ID: WP_014706133.1
Location: 933590..934501 (912 bp)
Type: Others
Protein ID: WP_014706134.1
Type: Others
Protein ID: WP_014706134.1
Location: 934642..934875 (234 bp)
Type: Others
Protein ID: WP_014706135.1
Type: Others
Protein ID: WP_014706135.1
Location: 934862..935128 (267 bp)
Type: Others
Protein ID: WP_041354373.1
Type: Others
Protein ID: WP_041354373.1
Location: 935165..935380 (216 bp)
Type: Others
Protein ID: WP_041354375.1
Type: Others
Protein ID: WP_041354375.1
Location: 935445..935783 (339 bp)
Type: Others
Protein ID: WP_014706136.1
Type: Others
Protein ID: WP_014706136.1
Location: 936006..936230 (225 bp)
Type: Toxin
Protein ID: WP_202971552.1
Type: Toxin
Protein ID: WP_202971552.1
Location: 936220..936510 (291 bp)
Type: Antitoxin
Protein ID: WP_202971553.1
Type: Antitoxin
Protein ID: WP_202971553.1
Location: 937800..938138 (339 bp)
Type: Others
Protein ID: WP_014706140.1
Type: Others
Protein ID: WP_014706140.1
Location: 939110..940957 (1848 bp)
Type: Others
Protein ID: WP_014706143.1
Type: Others
Protein ID: WP_014706143.1
Location: 936552..937397 (846 bp)
Type: Others
Protein ID: WP_014706139.1
Type: Others
Protein ID: WP_014706139.1
Location: 938200..938454 (255 bp)
Type: Others
Protein ID: WP_014706141.1
Type: Others
Protein ID: WP_014706141.1
Location: 938451..938702 (252 bp)
Type: Others
Protein ID: WP_014706142.1
Type: Others
Protein ID: WP_014706142.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
Q7A_RS04435 | 931835..932140 | + | 306 | WP_041354369.1 | hypothetical protein | - |
Q7A_RS04440 | 932330..933082 | + | 753 | WP_014706132.1 | hypothetical protein | - |
Q7A_RS15165 | 933315..933467 | + | 153 | WP_014706133.1 | hypothetical protein | - |
Q7A_RS04445 | 933590..934501 | + | 912 | WP_014706134.1 | hypothetical protein | - |
Q7A_RS04450 | 934642..934875 | + | 234 | WP_014706135.1 | hypothetical protein | - |
Q7A_RS04455 | 934862..935128 | + | 267 | WP_041354373.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Q7A_RS04460 | 935165..935380 | + | 216 | WP_041354375.1 | TIGR02450 family Trp-rich protein | - |
Q7A_RS04465 | 935445..935783 | + | 339 | WP_014706136.1 | thioredoxin family protein | - |
Q7A_RS04470 | 936006..936230 | + | 225 | WP_202971552.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
Q7A_RS04475 | 936220..936510 | + | 291 | WP_202971553.1 | helix-turn-helix domain-containing protein | Antitoxin |
Q7A_RS04480 | 936552..937397 | - | 846 | WP_014706139.1 | DNA ligase | - |
Q7A_RS04485 | 937800..938138 | + | 339 | WP_014706140.1 | thioredoxin family protein | - |
Q7A_RS04490 | 938200..938454 | - | 255 | WP_014706141.1 | Txe/YoeB family addiction module toxin | - |
Q7A_RS04495 | 938451..938702 | - | 252 | WP_014706142.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
Q7A_RS04500 | 939110..940957 | + | 1848 | WP_014706143.1 | lytic transglycosylase domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 75 a.a. Molecular weight: 8232.48 Da Isoelectric Point: 11.0521
>T27750 WP_202971552.1 NC_017857:936006-936230 [Methylophaga nitratireducenticrescens]
MQGTGGIRKLRWSAQGKGKSGGVRIIYFYHNGTMPLFLLTVFGKGEKANLSKSERNQLAKFTSLLRKHYGGNDD
MQGTGGIRKLRWSAQGKGKSGGVRIIYFYHNGTMPLFLLTVFGKGEKANLSKSERNQLAKFTSLLRKHYGGNDD
Download Length: 225 bp
>T27750 NC_017857:936006-936230 [Methylophaga nitratireducenticrescens]
ATGCAGGGCACGGGTGGAATTAGGAAGTTACGATGGTCTGCCCAAGGAAAAGGTAAAAGTGGTGGGGTTCGCATTATTTA
CTTCTACCACAATGGCACGATGCCGCTGTTTTTATTAACTGTATTCGGCAAAGGTGAAAAAGCGAATCTGAGCAAGTCCG
AGCGAAATCAACTTGCAAAATTCACCAGTCTTTTACGTAAGCACTATGGTGGCAATGATGACTAA
ATGCAGGGCACGGGTGGAATTAGGAAGTTACGATGGTCTGCCCAAGGAAAAGGTAAAAGTGGTGGGGTTCGCATTATTTA
CTTCTACCACAATGGCACGATGCCGCTGTTTTTATTAACTGTATTCGGCAAAGGTGAAAAAGCGAATCTGAGCAAGTCCG
AGCGAAATCAACTTGCAAAATTCACCAGTCTTTTACGTAAGCACTATGGTGGCAATGATGACTAA
Antitoxin
Download Length: 97 a.a. Molecular weight: 10458.10 Da Isoelectric Point: 10.5650
>AT27750 WP_202971553.1 NC_017857:936220-936510 [Methylophaga nitratireducenticrescens]
MMTNAFSSIKQGLTEAVEFSKGKSSKAVVHEFSPLDVKKIRTKVGMSQNEFASAFGISVSTLRHWERGDRTPQGPALVLL
NVVAKEPELVLRALAS
MMTNAFSSIKQGLTEAVEFSKGKSSKAVVHEFSPLDVKKIRTKVGMSQNEFASAFGISVSTLRHWERGDRTPQGPALVLL
NVVAKEPELVLRALAS
Download Length: 291 bp
>AT27750 NC_017857:936220-936510 [Methylophaga nitratireducenticrescens]
ATGATGACTAATGCATTTTCAAGTATTAAACAGGGTTTGACTGAGGCGGTAGAGTTTTCTAAAGGCAAGTCCAGTAAAGC
CGTGGTACACGAGTTTAGCCCGCTGGATGTAAAGAAGATTCGGACTAAAGTCGGTATGTCACAAAACGAATTTGCGTCGG
CGTTCGGTATAAGTGTCAGTACTCTCCGCCACTGGGAACGTGGTGATCGTACCCCGCAAGGACCCGCTCTGGTGCTTTTG
AATGTCGTCGCCAAAGAGCCGGAACTTGTGCTTCGTGCCTTGGCATCTTAG
ATGATGACTAATGCATTTTCAAGTATTAAACAGGGTTTGACTGAGGCGGTAGAGTTTTCTAAAGGCAAGTCCAGTAAAGC
CGTGGTACACGAGTTTAGCCCGCTGGATGTAAAGAAGATTCGGACTAAAGTCGGTATGTCACAAAACGAATTTGCGTCGG
CGTTCGGTATAAGTGTCAGTACTCTCCGCCACTGGGAACGTGGTGATCGTACCCCGCAAGGACCCGCTCTGGTGCTTTTG
AATGTCGTCGCCAAAGAGCCGGAACTTGTGCTTCGTGCCTTGGCATCTTAG