Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 610652..611451 | Replicon | chromosome |
| Accession | NZ_CP122648 | ||
| Organism | Escherichia coli strain ETEC4077 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A3A6SBL4 |
| Locus tag | QDY56_RS02940 | Protein ID | WP_062875446.1 |
| Coordinates | 610652..611116 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | QDY56_RS02945 | Protein ID | WP_001307405.1 |
| Coordinates | 611116..611451 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY56_RS02910 (605653) | 605653..606087 | - | 435 | WP_063086247.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QDY56_RS02915 (606105) | 606105..606983 | - | 879 | WP_192297513.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QDY56_RS02920 (606973) | 606973..607752 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QDY56_RS02925 (607763) | 607763..608236 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QDY56_RS02930 (608259) | 608259..609539 | - | 1281 | WP_063086249.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QDY56_RS02935 (609788) | 609788..610597 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
| QDY56_RS02940 (610652) | 610652..611116 | - | 465 | WP_062875446.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QDY56_RS02945 (611116) | 611116..611451 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QDY56_RS02950 (611600) | 611600..613171 | - | 1572 | WP_001273756.1 | galactarate dehydratase | - |
| QDY56_RS02955 (613546) | 613546..614880 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QDY56_RS02960 (614896) | 614896..615671 | + | 776 | Protein_578 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17844.22 Da Isoelectric Point: 9.4942
>T277499 WP_062875446.1 NZ_CP122648:c611116-610652 [Escherichia coli]
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3A6SBL4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |