Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4946495..4947097 | Replicon | chromosome |
Accession | NZ_CP122643 | ||
Organism | Escherichia coli strain ETEC4079 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QDW55_RS24495 | Protein ID | WP_000897305.1 |
Coordinates | 4946786..4947097 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDW55_RS24490 | Protein ID | WP_000356395.1 |
Coordinates | 4946495..4946785 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW55_RS24455 (4942118) | 4942118..4943020 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QDW55_RS24460 (4943017) | 4943017..4943652 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QDW55_RS24465 (4943649) | 4943649..4944578 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QDW55_RS24470 (4944760) | 4944760..4945002 | - | 243 | WP_001306649.1 | protein YiiF | - |
QDW55_RS24475 (4945221) | 4945221..4945439 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
QDW55_RS24480 (4945858) | 4945858..4946136 | - | 279 | WP_001306650.1 | hypothetical protein | - |
QDW55_RS24485 (4946198) | 4946198..4946410 | - | 213 | WP_000197769.1 | hypothetical protein | - |
QDW55_RS24490 (4946495) | 4946495..4946785 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
QDW55_RS24495 (4946786) | 4946786..4947097 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QDW55_RS24500 (4947326) | 4947326..4948234 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
QDW55_RS24505 (4948403) | 4948403..4949317 | - | 915 | WP_225102955.1 | transposase | - |
QDW55_RS24510 (4949330) | 4949330..4950217 | - | 888 | Protein_4797 | hypothetical protein | - |
QDW55_RS24515 (4950633) | 4950633..4951574 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QDW55_RS24520 (4951619) | 4951619..4952056 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277495 WP_000897305.1 NZ_CP122643:c4947097-4946786 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|