Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4030937..4031631 | Replicon | chromosome |
| Accession | NZ_CP122643 | ||
| Organism | Escherichia coli strain ETEC4079 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | A0A0D8WHS4 |
| Locus tag | QDW55_RS19920 | Protein ID | WP_001521903.1 |
| Coordinates | 4030937..4031335 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | QDW55_RS19925 | Protein ID | WP_000554755.1 |
| Coordinates | 4031338..4031631 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW55_RS19890 (4026071) | 4026071..4027528 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| QDW55_RS19895 (4027537) | 4027537..4027818 | + | 282 | WP_077881290.1 | hypothetical protein | - |
| QDW55_RS19900 (4027835) | 4027835..4028344 | - | 510 | WP_063085380.1 | metal-dependent hydrolase | - |
| QDW55_RS19905 (4028406) | 4028406..4029020 | - | 615 | WP_000602129.1 | peptide chain release factor H | - |
| QDW55_RS19910 (4029017) | 4029017..4030156 | - | 1140 | WP_063085369.1 | RNA ligase RtcB family protein | - |
| QDW55_RS19915 (4030475) | 4030475..4030927 | - | 453 | WP_001059858.1 | GNAT family N-acetyltransferase | - |
| QDW55_RS19920 (4030937) | 4030937..4031335 | - | 399 | WP_001521903.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QDW55_RS19925 (4031338) | 4031338..4031631 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QDW55_RS19930 (4031683) | 4031683..4032738 | - | 1056 | WP_192297422.1 | DNA polymerase IV | - |
| QDW55_RS19935 (4032809) | 4032809..4033594 | - | 786 | WP_074150236.1 | putative lateral flagellar export/assembly protein LafU | - |
| QDW55_RS19940 (4033566) | 4033566..4035278 | + | 1713 | Protein_3912 | flagellar biosynthesis protein FlhA | - |
| QDW55_RS19945 (4035383) | 4035383..4035661 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| QDW55_RS19950 (4035654) | 4035654..4036010 | + | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15471.88 Da Isoelectric Point: 8.0949
>T277490 WP_001521903.1 NZ_CP122643:c4031335-4030937 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D8WHS4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |