Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4030937..4031631 Replicon chromosome
Accession NZ_CP122643
Organism Escherichia coli strain ETEC4079

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag QDW55_RS19920 Protein ID WP_001521903.1
Coordinates 4030937..4031335 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag QDW55_RS19925 Protein ID WP_000554755.1
Coordinates 4031338..4031631 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW55_RS19890 (4026071) 4026071..4027528 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
QDW55_RS19895 (4027537) 4027537..4027818 + 282 WP_077881290.1 hypothetical protein -
QDW55_RS19900 (4027835) 4027835..4028344 - 510 WP_063085380.1 metal-dependent hydrolase -
QDW55_RS19905 (4028406) 4028406..4029020 - 615 WP_000602129.1 peptide chain release factor H -
QDW55_RS19910 (4029017) 4029017..4030156 - 1140 WP_063085369.1 RNA ligase RtcB family protein -
QDW55_RS19915 (4030475) 4030475..4030927 - 453 WP_001059858.1 GNAT family N-acetyltransferase -
QDW55_RS19920 (4030937) 4030937..4031335 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDW55_RS19925 (4031338) 4031338..4031631 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDW55_RS19930 (4031683) 4031683..4032738 - 1056 WP_192297422.1 DNA polymerase IV -
QDW55_RS19935 (4032809) 4032809..4033594 - 786 WP_074150236.1 putative lateral flagellar export/assembly protein LafU -
QDW55_RS19940 (4033566) 4033566..4035278 + 1713 Protein_3912 flagellar biosynthesis protein FlhA -
QDW55_RS19945 (4035383) 4035383..4035661 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
QDW55_RS19950 (4035654) 4035654..4036010 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T277490 WP_001521903.1 NZ_CP122643:c4031335-4030937 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT277490 WP_000554755.1 NZ_CP122643:c4031631-4031338 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References