Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 610648..611447 | Replicon | chromosome |
Accession | NZ_CP122643 | ||
Organism | Escherichia coli strain ETEC4079 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A3A6SBL4 |
Locus tag | QDW55_RS02940 | Protein ID | WP_062875446.1 |
Coordinates | 610648..611112 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QDW55_RS02945 | Protein ID | WP_001307405.1 |
Coordinates | 611112..611447 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW55_RS02910 (605649) | 605649..606083 | - | 435 | WP_063086247.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QDW55_RS02915 (606101) | 606101..606979 | - | 879 | WP_192297513.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QDW55_RS02920 (606969) | 606969..607748 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QDW55_RS02925 (607759) | 607759..608232 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QDW55_RS02930 (608255) | 608255..609535 | - | 1281 | WP_063086249.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QDW55_RS02935 (609784) | 609784..610593 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
QDW55_RS02940 (610648) | 610648..611112 | - | 465 | WP_062875446.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QDW55_RS02945 (611112) | 611112..611447 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QDW55_RS02950 (611596) | 611596..613167 | - | 1572 | WP_001273756.1 | galactarate dehydratase | - |
QDW55_RS02955 (613542) | 613542..614876 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
QDW55_RS02960 (614892) | 614892..615667 | + | 776 | Protein_578 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 610648..621940 | 11292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17844.22 Da Isoelectric Point: 9.4942
>T277474 WP_062875446.1 NZ_CP122643:c611112-610648 [Escherichia coli]
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A6SBL4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |