Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4201355..4202049 | Replicon | chromosome |
Accession | NZ_CP122634 | ||
Organism | Escherichia coli strain ETEC4085 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | A0A3A6T3I6 |
Locus tag | QDW62_RS21210 | Protein ID | WP_001263490.1 |
Coordinates | 4201355..4201753 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | QDW62_RS21215 | Protein ID | WP_000554757.1 |
Coordinates | 4201756..4202049 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (4197015) | 4197015..4197095 | - | 81 | NuclAT_9 | - | - |
- (4197015) | 4197015..4197095 | - | 81 | NuclAT_9 | - | - |
- (4197015) | 4197015..4197095 | - | 81 | NuclAT_9 | - | - |
- (4197015) | 4197015..4197095 | - | 81 | NuclAT_9 | - | - |
QDW62_RS21180 (4196355) | 4196355..4197599 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
QDW62_RS21185 (4197691) | 4197691..4198149 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
QDW62_RS21190 (4198410) | 4198410..4199867 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
QDW62_RS21195 (4199924) | 4199924..4200445 | - | 522 | Protein_4148 | peptide chain release factor H | - |
QDW62_RS21200 (4200444) | 4200444..4200647 | - | 204 | Protein_4149 | RtcB family protein | - |
QDW62_RS21205 (4200893) | 4200893..4201345 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
QDW62_RS21210 (4201355) | 4201355..4201753 | - | 399 | WP_001263490.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QDW62_RS21215 (4201756) | 4201756..4202049 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QDW62_RS21220 (4202101) | 4202101..4203156 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
QDW62_RS21225 (4203227) | 4203227..4204012 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
QDW62_RS21230 (4203984) | 4203984..4205696 | + | 1713 | Protein_4155 | flagellar biosynthesis protein FlhA | - |
QDW62_RS21235 (4205920) | 4205920..4206417 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4153747..4207219 | 53472 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15486.86 Da Isoelectric Point: 8.0949
>T277456 WP_001263490.1 NZ_CP122634:c4201753-4201355 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLLYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLLYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A6T3I6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1FJN6 |