Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 7498..7762 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP122631 | ||
| Organism | Escherichia coli strain ETEC4088 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | QDW58_RS24195 | Protein ID | WP_001331364.1 |
| Coordinates | 7610..7762 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 7498..7555 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW58_RS24180 (2737) | 2737..5028 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| QDW58_RS24185 (5021) | 5021..6091 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| QDW58_RS24190 (6110) | 6110..7318 | - | 1209 | WP_000121274.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (7498) | 7498..7555 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (7498) | 7498..7555 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (7498) | 7498..7555 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (7498) | 7498..7555 | - | 58 | NuclAT_0 | - | Antitoxin |
| QDW58_RS24195 (7610) | 7610..7762 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| QDW58_RS24200 (7834) | 7834..7974 | - | 141 | WP_000880644.1 | hypothetical protein | - |
| QDW58_RS24205 (8586) | 8586..8681 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| QDW58_RS24210 (8746) | 8746..8922 | - | 177 | WP_001054904.1 | hypothetical protein | - |
| QDW58_RS24215 (9314) | 9314..9523 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| QDW58_RS24220 (9595) | 9595..10257 | - | 663 | WP_000653334.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QDW58_RS24225 (10322) | 10322..12484 | - | 2163 | WP_000698351.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / qacE / ant(3'')-Ia / dfrA1 / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B | - | 1..110098 | 110098 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T277426 WP_001331364.1 NZ_CP122631:7610-7762 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT277426 NZ_CP122631:c7555-7498 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
