Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4780034..4780636 | Replicon | chromosome |
| Accession | NZ_CP122629 | ||
| Organism | Escherichia coli strain ETEC4088 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | QDW58_RS23175 | Protein ID | WP_000897305.1 |
| Coordinates | 4780325..4780636 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QDW58_RS23170 | Protein ID | WP_000356397.1 |
| Coordinates | 4780034..4780324 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW58_RS23145 (4775979) | 4775979..4776881 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QDW58_RS23150 (4776878) | 4776878..4777513 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QDW58_RS23155 (4777510) | 4777510..4778439 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| QDW58_RS23160 (4778769) | 4778769..4779011 | - | 243 | WP_001087409.1 | protein YiiF | - |
| QDW58_RS23165 (4779230) | 4779230..4779448 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| QDW58_RS23170 (4780034) | 4780034..4780324 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QDW58_RS23175 (4780325) | 4780325..4780636 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| QDW58_RS23180 (4780865) | 4780865..4781773 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| QDW58_RS23185 (4781837) | 4781837..4782778 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QDW58_RS23190 (4782823) | 4782823..4783260 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| QDW58_RS23195 (4783257) | 4783257..4784129 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QDW58_RS23200 (4784123) | 4784123..4784722 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277425 WP_000897305.1 NZ_CP122629:c4780636-4780325 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|