Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 16152..16798 Replicon plasmid unnamed2
Accession NZ_CP122627
Organism Escherichia coli strain ETEC4089

Toxin (Protein)


Gene name higB Uniprot ID F4T8Q4
Locus tag QDW64_RS23635 Protein ID WP_000269926.1
Coordinates 16152..16502 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID F4T8Q5
Locus tag QDW64_RS23640 Protein ID WP_001259443.1
Coordinates 16499..16798 (+) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW64_RS23605 (QDW64_23600) 12875..13609 + 735 WP_000905147.1 MobC family replication-relaxation protein -
QDW64_RS23610 (QDW64_23605) 13613..14077 + 465 WP_000697615.1 thermonuclease family protein -
QDW64_RS23615 (QDW64_23610) 14087..14392 + 306 Protein_17 hypothetical protein -
QDW64_RS23620 (QDW64_23615) 14571..14834 + 264 WP_001312455.1 PilI type IV pilus biogenesis protein -
QDW64_RS23625 (QDW64_23620) 14866..15099 - 234 WP_000024515.1 hypothetical protein -
QDW64_RS23630 (QDW64_23625) 15139..15786 - 648 WP_000214917.1 ParA family protein -
QDW64_RS23635 (QDW64_23630) 16152..16502 + 351 WP_000269926.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDW64_RS23640 (QDW64_23635) 16499..16798 + 300 WP_001259443.1 XRE family transcriptional regulator Antitoxin
QDW64_RS23645 (QDW64_23640) 16829..17074 - 246 WP_001193619.1 hypothetical protein -
QDW64_RS23650 (QDW64_23645) 17064..17321 - 258 WP_000845367.1 hypothetical protein -
QDW64_RS23655 (QDW64_23650) 17357..17899 - 543 WP_000206647.1 hypothetical protein -
QDW64_RS23660 (QDW64_23655) 18027..18560 - 534 WP_001025389.1 J domain-containing protein -
QDW64_RS23665 (QDW64_23660) 18931..19230 - 300 WP_000113288.1 hypothetical protein -
QDW64_RS23670 (QDW64_23665) 19304..19576 - 273 WP_001272119.1 hypothetical protein -
QDW64_RS23675 (QDW64_23670) 20527..21192 - 666 WP_001350943.1 RepA family replication protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..24405 24405


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-105)

Antitoxin

Cro/C1-type helix-turn-helix domain

(32-80)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13742.77 Da        Isoelectric Point: 7.4217

>T277405 WP_000269926.1 NZ_CP122627:16152-16502 [Escherichia coli]
MWTVYFGRLFDEWFEEQELALKRKVLAELKHLEEFGPSLSRPHADTVKGSRHKNMKELRIQYEGHPIRAFFAFDPIRQAI
ILCAGDKSNDKKFYDRMIRIADEEFSTHLAELEGKK

Download         Length: 351 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 10917.70 Da        Isoelectric Point: 4.6283

>AT277405 WP_001259443.1 NZ_CP122627:16499-16798 [Escherichia coli]
MRTLEEVIAAQSPESQAIIKAMADEMILETGLQMMREELQLSQKQVADAMGISQPAVTQLEQRGNDLKLATLKRYVEAMG
GKLSLDVELPTGKRVAFNI

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A743U745

Antitoxin

Source ID Structure
AlphaFold DB A0A743U677

References