Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 649028..649755 | Replicon | chromosome |
Accession | NZ_CP122625 | ||
Organism | Escherichia coli strain ETEC4089 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | QDW64_RS03180 | Protein ID | WP_000550189.1 |
Coordinates | 649028..649342 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDW64_RS03185 | Protein ID | WP_000560266.1 |
Coordinates | 649339..649755 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW64_RS03160 (645195) | 645195..646181 | - | 987 | WP_023281494.1 | Gfo/Idh/MocA family oxidoreductase | - |
QDW64_RS03165 (646260) | 646260..646943 | - | 684 | WP_001183042.1 | vancomycin high temperature exclusion protein | - |
QDW64_RS03170 (647020) | 647020..647523 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
QDW64_RS03175 (647608) | 647608..648744 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
QDW64_RS03180 (649028) | 649028..649342 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
QDW64_RS03185 (649339) | 649339..649755 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
QDW64_RS03190 (649800) | 649800..651818 | - | 2019 | WP_049253702.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
QDW64_RS03195 (652244) | 652244..654595 | - | 2352 | WP_024238710.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T277386 WP_000550189.1 NZ_CP122625:649028-649342 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT277386 WP_000560266.1 NZ_CP122625:649339-649755 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|