Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 7498..7762 Replicon plasmid unnamed3
Accession NZ_CP122623
Organism Escherichia coli strain ETEC4090

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag QDW69_RS27660 Protein ID WP_001331364.1
Coordinates 7610..7762 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 7498..7555 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW69_RS27645 (2737) 2737..5028 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
QDW69_RS27650 (5021) 5021..6091 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
QDW69_RS27655 (6110) 6110..7318 - 1209 WP_000121274.1 IncI1-type conjugal transfer protein TrbA -
- (7498) 7498..7555 - 58 NuclAT_0 - Antitoxin
- (7498) 7498..7555 - 58 NuclAT_0 - Antitoxin
- (7498) 7498..7555 - 58 NuclAT_0 - Antitoxin
- (7498) 7498..7555 - 58 NuclAT_0 - Antitoxin
QDW69_RS27660 (7610) 7610..7762 + 153 WP_001331364.1 Hok/Gef family protein Toxin
QDW69_RS27665 (7834) 7834..8085 - 252 WP_001291965.1 hypothetical protein -
QDW69_RS27670 (8586) 8586..8681 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
QDW69_RS27675 (8746) 8746..8922 - 177 WP_001054904.1 hypothetical protein -
QDW69_RS27680 (9314) 9314..9523 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
QDW69_RS27685 (9595) 9595..10257 - 663 WP_000653334.1 plasmid IncI1-type surface exclusion protein ExcA -
QDW69_RS27690 (10322) 10322..12484 - 2163 WP_000698351.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul1 / qacE / ant(3'')-Ia / dfrA1 / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B - 1..107589 107589


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T277378 WP_001331364.1 NZ_CP122623:7610-7762 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT277378 NZ_CP122623:c7555-7498 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References