Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-agrB/- |
| Location | 18557..18915 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP122622 | ||
| Organism | Escherichia coli strain ETEC4090 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QDW69_RS27040 | Protein ID | WP_151318007.1 |
| Coordinates | 18814..18915 (+) | Length | 34 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 18557..18705 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW69_RS27000 (13786) | 13786..13992 | + | 207 | WP_000547945.1 | hypothetical protein | - |
| QDW69_RS27005 (14018) | 14018..14548 | + | 531 | WP_032214168.1 | single-stranded DNA-binding protein | - |
| QDW69_RS27010 (14604) | 14604..14837 | + | 234 | WP_000005971.1 | DUF905 domain-containing protein | - |
| QDW69_RS27015 (14901) | 14901..16858 | + | 1958 | Protein_24 | ParB/RepB/Spo0J family partition protein | - |
| QDW69_RS27020 (16913) | 16913..17347 | + | 435 | WP_042634413.1 | conjugation system SOS inhibitor PsiB | - |
| QDW69_RS27025 (17344) | 17344..18063 | + | 720 | WP_042634414.1 | plasmid SOS inhibition protein A | - |
| QDW69_RS27030 (18063) | 18063..18581 | + | 519 | WP_001178554.1 | hypothetical protein | - |
| - (18557) | 18557..18705 | + | 149 | NuclAT_0 | - | Antitoxin |
| - (18557) | 18557..18705 | + | 149 | NuclAT_0 | - | Antitoxin |
| - (18557) | 18557..18705 | + | 149 | NuclAT_0 | - | Antitoxin |
| - (18557) | 18557..18705 | + | 149 | NuclAT_0 | - | Antitoxin |
| QDW69_RS27035 (18771) | 18771..18848 | + | 78 | Protein_28 | DUF5431 family protein | - |
| QDW69_RS27040 (18814) | 18814..18915 | + | 102 | WP_151318007.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QDW69_RS27045 (19216) | 19216..19512 | - | 297 | Protein_30 | hypothetical protein | - |
| QDW69_RS27050 (19736) | 19736..20032 | + | 297 | WP_001272240.1 | hypothetical protein | - |
| QDW69_RS27055 (20138) | 20138..20959 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| QDW69_RS27060 (21256) | 21256..21858 | - | 603 | WP_000243703.1 | transglycosylase SLT domain-containing protein | - |
| QDW69_RS27065 (22179) | 22179..22562 | + | 384 | WP_001151530.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QDW69_RS27070 (22694) | 22694..23401 | + | 708 | WP_250697969.1 | transcriptional regulator TraJ family protein | - |
| QDW69_RS27075 (23521) | 23521..23748 | + | 228 | WP_000589558.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | hlyD / hlyB / hlyA / hlyC / estIa | 1..120673 | 120673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 34 a.a. Molecular weight: 3921.52 Da Isoelectric Point: 7.9707
>T277373 WP_151318007.1 NZ_CP122622:18814-18915 [Escherichia coli]
MIFTYLTRKSLCEIRYRDGDREVAAFMAYESGK
MIFTYLTRKSLCEIRYRDGDREVAAFMAYESGK
Download Length: 102 bp
Antitoxin
Download Length: 149 bp
>AT277373 NZ_CP122622:18557-18705 [Escherichia coli]
CAGGGTGCAGACATATGGGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGT
GTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGCATCCCATATGTCT
CAGGGTGCAGACATATGGGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGT
GTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGCATCCCATATGTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
