Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4219937..4220631 | Replicon | chromosome |
| Accession | NZ_CP122620 | ||
| Organism | Escherichia coli strain ETEC4090 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | QDW69_RS21495 | Protein ID | WP_001263489.1 |
| Coordinates | 4219937..4220335 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | QDW69_RS21500 | Protein ID | WP_000554758.1 |
| Coordinates | 4220338..4220631 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (4215525) | 4215525..4215605 | - | 81 | NuclAT_13 | - | - |
| - (4215525) | 4215525..4215605 | - | 81 | NuclAT_13 | - | - |
| - (4215525) | 4215525..4215605 | - | 81 | NuclAT_13 | - | - |
| - (4215525) | 4215525..4215605 | - | 81 | NuclAT_13 | - | - |
| QDW69_RS21470 (4216201) | 4216201..4216659 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| QDW69_RS21475 (4216920) | 4216920..4218377 | + | 1458 | WP_230905590.1 | cytosol nonspecific dipeptidase | - |
| QDW69_RS21480 (4218434) | 4218434..4218955 | - | 522 | Protein_4205 | peptide chain release factor H | - |
| QDW69_RS21485 (4218951) | 4218951..4219157 | - | 207 | Protein_4206 | RtcB family protein | - |
| QDW69_RS21490 (4219475) | 4219475..4219927 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| QDW69_RS21495 (4219937) | 4219937..4220335 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QDW69_RS21500 (4220338) | 4220338..4220631 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QDW69_RS21505 (4220683) | 4220683..4221738 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| QDW69_RS21510 (4221809) | 4221809..4222594 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| QDW69_RS21515 (4222566) | 4222566..4224278 | + | 1713 | Protein_4212 | flagellar biosynthesis protein FlhA | - |
| QDW69_RS21520 (4224502) | 4224502..4224999 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T277368 WP_001263489.1 NZ_CP122620:c4220335-4219937 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |