Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2640445..2640816 | Replicon | chromosome |
| Accession | NZ_CP122620 | ||
| Organism | Escherichia coli strain ETEC4090 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A839BBC2 |
| Locus tag | QDW69_RS13120 | Protein ID | WP_021500490.1 |
| Coordinates | 2640445..2640639 (+) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2640638..2640816 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW69_RS13100 (2635575) | 2635575..2635745 | + | 171 | WP_065336296.1 | YdaE family protein | - |
| QDW69_RS13105 (2635820) | 2635820..2636095 | + | 276 | WP_001372690.1 | hypothetical protein | - |
| QDW69_RS13110 (2636195) | 2636195..2639317 | + | 3123 | WP_000105090.1 | exodeoxyribonuclease VIII | - |
| QDW69_RS13115 (2639329) | 2639329..2640381 | + | 1053 | WP_001004412.1 | RecT family recombinase | - |
| QDW69_RS13120 (2640445) | 2640445..2640639 | + | 195 | WP_021500490.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| - (2640638) | 2640638..2640816 | - | 179 | NuclAT_6 | - | Antitoxin |
| - (2640638) | 2640638..2640816 | - | 179 | NuclAT_6 | - | Antitoxin |
| - (2640638) | 2640638..2640816 | - | 179 | NuclAT_6 | - | Antitoxin |
| - (2640638) | 2640638..2640816 | - | 179 | NuclAT_6 | - | Antitoxin |
| QDW69_RS13125 (2640632) | 2640632..2640820 | + | 189 | WP_001372676.1 | DUF1187 family protein | - |
| QDW69_RS13130 (2640920) | 2640920..2641135 | + | 216 | WP_000079604.1 | excisionase XisR | - |
| QDW69_RS13135 (2641137) | 2641137..2642372 | + | 1236 | WP_024168543.1 | site-specific integrase | - |
| QDW69_RS13140 (2642424) | 2642424..2643359 | + | 936 | WP_001157381.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| QDW69_RS13145 (2643488) | 2643488..2644861 | - | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
| QDW69_RS13150 (2644891) | 2644891..2645064 | - | 174 | WP_001296046.1 | protein YnaL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2594347..2642372 | 48025 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7046.98 Da Isoelectric Point: 9.2886
>T277363 WP_021500490.1 NZ_CP122620:2640445-2640639 [Escherichia coli]
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT277363 NZ_CP122620:c2640816-2640638 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGCTGGTAGGAGAACCACCTTCCTTTT
CAATAGTGGCGGTGATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGCTGGTAGGAGAACCACCTTCCTTTT
CAATAGTGGCGGTGATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
