Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralR-sib/- |
Location | 2075459..2075830 | Replicon | chromosome |
Accession | NZ_CP122620 | ||
Organism | Escherichia coli strain ETEC4090 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | - |
Locus tag | QDW69_RS10270 | Protein ID | WP_187182214.1 |
Coordinates | 2075636..2075830 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | sib | ||
Locus tag | - | ||
Coordinates | 2075459..2075637 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW69_RS10230 (2070901) | 2070901..2071557 | - | 657 | WP_000011658.1 | carbon-nitrogen hydrolase family protein YobB | - |
QDW69_RS10235 (2071659) | 2071659..2071889 | - | 231 | WP_000916763.1 | DNA polymerase III subunit theta | - |
QDW69_RS10240 (2072028) | 2072028..2072402 | + | 375 | WP_000168747.1 | CopC domain-containing protein YobA | - |
QDW69_RS10245 (2072406) | 2072406..2073278 | + | 873 | WP_000879289.1 | copper homeostasis membrane protein CopD | - |
QDW69_RS10250 (2073291) | 2073291..2073632 | + | 342 | WP_000976476.1 | YebY family protein | - |
QDW69_RS10255 (2074025) | 2074025..2075101 | - | 1077 | WP_053508942.1 | phage integrase Arm DNA-binding domain-containing protein | - |
QDW69_RS10260 (2075067) | 2075067..2075348 | - | 282 | WP_077248935.1 | excisionase | - |
- (2075459) | 2075459..2075637 | + | 179 | NuclAT_5 | - | Antitoxin |
- (2075459) | 2075459..2075637 | + | 179 | NuclAT_5 | - | Antitoxin |
- (2075459) | 2075459..2075637 | + | 179 | NuclAT_5 | - | Antitoxin |
- (2075459) | 2075459..2075637 | + | 179 | NuclAT_5 | - | Antitoxin |
QDW69_RS10265 (2075455) | 2075455..2075643 | - | 189 | WP_021529595.1 | DUF1187 family protein | - |
QDW69_RS10270 (2075636) | 2075636..2075830 | - | 195 | WP_187182214.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
QDW69_RS10275 (2075894) | 2075894..2076982 | - | 1089 | WP_230905604.1 | RecT family recombinase | - |
QDW69_RS10280 (2076997) | 2076997..2080116 | - | 3120 | WP_230905603.1 | exodeoxyribonuclease VIII | - |
QDW69_RS10285 (2080140) | 2080140..2080436 | - | 297 | WP_023908491.1 | hypothetical protein | - |
QDW69_RS10290 (2080511) | 2080511..2080681 | - | 171 | WP_230905606.1 | Rtr1/RPAP2 family protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1997902..2126330 | 128428 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7032.96 Da Isoelectric Point: 9.2886
>T277357 WP_187182214.1 NZ_CP122620:c2075830-2075636 [Escherichia coli]
MRYEKVKPCPFCGCPSVTVKGISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYEKVKPCPFCGCPSVTVKGISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT277357 NZ_CP122620:2075459-2075637 [Escherichia coli]
GAGGGCAGAAGTTTCTCGCAATTAAAATTTATCAGCTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCCGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGGCAGAAGTTTCTCGCAATTAAAATTTATCAGCTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCCGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|