Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 731841..732534 | Replicon | chromosome |
Accession | NZ_CP122620 | ||
Organism | Escherichia coli strain ETEC4090 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | QDW69_RS03615 | Protein ID | WP_000415584.1 |
Coordinates | 731841..732137 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QDW69_RS03620 | Protein ID | WP_000650107.1 |
Coordinates | 732139..732534 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW69_RS03580 (726929) | 726929..727243 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
QDW69_RS03585 (727274) | 727274..727855 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
QDW69_RS03590 (728174) | 728174..728506 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
QDW69_RS03595 (728552) | 728552..729901 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
QDW69_RS03600 (729898) | 729898..730557 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
QDW69_RS03605 (730709) | 730709..731101 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QDW69_RS03610 (731154) | 731154..731636 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
QDW69_RS03615 (731841) | 731841..732137 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QDW69_RS03620 (732139) | 732139..732534 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QDW69_RS03625 (732667) | 732667..734274 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
QDW69_RS03630 (734412) | 734412..736670 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T277348 WP_000415584.1 NZ_CP122620:731841-732137 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT277348 WP_000650107.1 NZ_CP122620:732139-732534 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|