Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 655479..656206 | Replicon | chromosome |
| Accession | NZ_CP122620 | ||
| Organism | Escherichia coli strain ETEC4090 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | QDW69_RS03230 | Protein ID | WP_000550189.1 |
| Coordinates | 655479..655793 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QDW69_RS03235 | Protein ID | WP_000560266.1 |
| Coordinates | 655790..656206 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW69_RS03210 (651637) | 651637..652623 | - | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
| QDW69_RS03215 (652702) | 652702..653394 | - | 693 | WP_000942548.1 | vancomycin high temperature exclusion protein | - |
| QDW69_RS03220 (653471) | 653471..653974 | - | 504 | WP_001333820.1 | M48 family metallopeptidase | - |
| QDW69_RS03225 (654059) | 654059..655195 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| QDW69_RS03230 (655479) | 655479..655793 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| QDW69_RS03235 (655790) | 655790..656206 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| QDW69_RS03240 (656251) | 656251..658269 | - | 2019 | WP_000121433.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| QDW69_RS03245 (658695) | 658695..660389 | - | 1695 | WP_230905488.1 | alpha-glucosidase | - |
| QDW69_RS03250 (660423) | 660423..661046 | - | 624 | WP_000695468.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T277347 WP_000550189.1 NZ_CP122620:655479-655793 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT277347 WP_000560266.1 NZ_CP122620:655790-656206 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|