Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4662890..4663492 | Replicon | chromosome |
| Accession | NZ_CP122617 | ||
| Organism | Escherichia coli strain ETEC4091 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | QDW52_RS22570 | Protein ID | WP_000897305.1 |
| Coordinates | 4663181..4663492 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QDW52_RS22565 | Protein ID | WP_000356397.1 |
| Coordinates | 4662890..4663180 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW52_RS22540 (4658815) | 4658815..4659717 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QDW52_RS22545 (4659714) | 4659714..4660349 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QDW52_RS22550 (4660346) | 4660346..4661275 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| QDW52_RS22555 (4661605) | 4661605..4661847 | - | 243 | WP_001087409.1 | protein YiiF | - |
| QDW52_RS22560 (4662067) | 4662067..4662285 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
| QDW52_RS22565 (4662890) | 4662890..4663180 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QDW52_RS22570 (4663181) | 4663181..4663492 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| QDW52_RS22575 (4663721) | 4663721..4664629 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| QDW52_RS22580 (4664693) | 4664693..4665634 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QDW52_RS22585 (4665679) | 4665679..4666116 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| QDW52_RS22590 (4666113) | 4666113..4666985 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QDW52_RS22595 (4666979) | 4666979..4667578 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| QDW52_RS22600 (4667677) | 4667677..4668462 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277343 WP_000897305.1 NZ_CP122617:c4663492-4663181 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|