Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3996243..3996937 Replicon chromosome
Accession NZ_CP122604
Organism Escherichia coli strain ETEC6334

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag QDW51_RS19685 Protein ID WP_001521903.1
Coordinates 3996243..3996641 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag QDW51_RS19690 Protein ID WP_000554755.1
Coordinates 3996644..3996937 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW51_RS19655 (3991377) 3991377..3992834 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
QDW51_RS19660 (3992843) 3992843..3993124 + 282 WP_077881290.1 hypothetical protein -
QDW51_RS19665 (3993141) 3993141..3993650 - 510 WP_063085380.1 metal-dependent hydrolase -
QDW51_RS19670 (3993712) 3993712..3994326 - 615 WP_000602129.1 peptide chain release factor H -
QDW51_RS19675 (3994323) 3994323..3995462 - 1140 WP_063085369.1 RNA ligase RtcB family protein -
QDW51_RS19680 (3995781) 3995781..3996233 - 453 WP_001059858.1 GNAT family N-acetyltransferase -
QDW51_RS19685 (3996243) 3996243..3996641 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDW51_RS19690 (3996644) 3996644..3996937 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDW51_RS19695 (3996989) 3996989..3998044 - 1056 WP_001226166.1 DNA polymerase IV -
QDW51_RS19700 (3998115) 3998115..3998900 - 786 WP_074150236.1 putative lateral flagellar export/assembly protein LafU -
QDW51_RS19705 (3998872) 3998872..4000584 + 1713 Protein_3862 flagellar biosynthesis protein FlhA -
QDW51_RS19710 (4000689) 4000689..4000967 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
QDW51_RS19715 (4000960) 4000960..4001316 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T277314 WP_001521903.1 NZ_CP122604:c3996641-3996243 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT277314 WP_000554755.1 NZ_CP122604:c3996937-3996644 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References