Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 624978..625777 | Replicon | chromosome |
| Accession | NZ_CP122604 | ||
| Organism | Escherichia coli strain ETEC6334 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A3A6SBL4 |
| Locus tag | QDW51_RS03025 | Protein ID | WP_062875446.1 |
| Coordinates | 624978..625442 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | QDW51_RS03030 | Protein ID | WP_001307405.1 |
| Coordinates | 625442..625777 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW51_RS02995 (619979) | 619979..620413 | - | 435 | WP_063086247.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QDW51_RS03000 (620431) | 620431..621309 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QDW51_RS03005 (621299) | 621299..622078 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QDW51_RS03010 (622089) | 622089..622562 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QDW51_RS03015 (622585) | 622585..623865 | - | 1281 | WP_063086249.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QDW51_RS03020 (624114) | 624114..624923 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
| QDW51_RS03025 (624978) | 624978..625442 | - | 465 | WP_062875446.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QDW51_RS03030 (625442) | 625442..625777 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QDW51_RS03035 (625926) | 625926..627497 | - | 1572 | WP_001273756.1 | galactarate dehydratase | - |
| QDW51_RS03040 (627872) | 627872..629206 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QDW51_RS03045 (629222) | 629222..629997 | + | 776 | Protein_595 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17844.22 Da Isoelectric Point: 9.4942
>T277296 WP_062875446.1 NZ_CP122604:c625442-624978 [Escherichia coli]
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3A6SBL4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |