Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4935149..4935751 | Replicon | chromosome |
Accession | NZ_CP122600 | ||
Organism | Escherichia coli strain ETEC6333 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QDX83_RS24360 | Protein ID | WP_000897305.1 |
Coordinates | 4935440..4935751 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDX83_RS24355 | Protein ID | WP_000356395.1 |
Coordinates | 4935149..4935439 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX83_RS24320 (4930773) | 4930773..4931675 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QDX83_RS24325 (4931672) | 4931672..4932307 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QDX83_RS24330 (4932304) | 4932304..4933233 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QDX83_RS24335 (4933415) | 4933415..4933657 | - | 243 | WP_001306649.1 | protein YiiF | - |
QDX83_RS24340 (4933876) | 4933876..4934094 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
QDX83_RS24345 (4934513) | 4934513..4934791 | - | 279 | WP_001306650.1 | hypothetical protein | - |
QDX83_RS24350 (4934843) | 4934843..4935064 | - | 222 | WP_001550354.1 | hypothetical protein | - |
QDX83_RS24355 (4935149) | 4935149..4935439 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
QDX83_RS24360 (4935440) | 4935440..4935751 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QDX83_RS24365 (4935980) | 4935980..4936888 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
QDX83_RS24370 (4937057) | 4937057..4937971 | - | 915 | WP_225102955.1 | transposase | - |
QDX83_RS24375 (4937984) | 4937984..4938871 | - | 888 | Protein_4767 | hypothetical protein | - |
QDX83_RS24380 (4939287) | 4939287..4940228 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QDX83_RS24385 (4940273) | 4940273..4940710 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277294 WP_000897305.1 NZ_CP122600:c4935751-4935440 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|