Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3996228..3996922 | Replicon | chromosome |
| Accession | NZ_CP122600 | ||
| Organism | Escherichia coli strain ETEC6333 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | A0A0D8WHS4 |
| Locus tag | QDX83_RS19690 | Protein ID | WP_001521903.1 |
| Coordinates | 3996228..3996626 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | QDX83_RS19695 | Protein ID | WP_000554755.1 |
| Coordinates | 3996629..3996922 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX83_RS19660 (3991362) | 3991362..3992819 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| QDX83_RS19665 (3992828) | 3992828..3993109 | + | 282 | WP_077881290.1 | hypothetical protein | - |
| QDX83_RS19670 (3993126) | 3993126..3993635 | - | 510 | WP_063085380.1 | metal-dependent hydrolase | - |
| QDX83_RS19675 (3993697) | 3993697..3994311 | - | 615 | WP_000602129.1 | peptide chain release factor H | - |
| QDX83_RS19680 (3994308) | 3994308..3995447 | - | 1140 | WP_063085369.1 | RNA ligase RtcB family protein | - |
| QDX83_RS19685 (3995766) | 3995766..3996218 | - | 453 | WP_001059858.1 | GNAT family N-acetyltransferase | - |
| QDX83_RS19690 (3996228) | 3996228..3996626 | - | 399 | WP_001521903.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QDX83_RS19695 (3996629) | 3996629..3996922 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QDX83_RS19700 (3996974) | 3996974..3998029 | - | 1056 | WP_001226166.1 | DNA polymerase IV | - |
| QDX83_RS19705 (3998100) | 3998100..3998885 | - | 786 | WP_074150236.1 | putative lateral flagellar export/assembly protein LafU | - |
| QDX83_RS19710 (3998857) | 3998857..4000569 | + | 1713 | Protein_3863 | flagellar biosynthesis protein FlhA | - |
| QDX83_RS19715 (4000674) | 4000674..4000952 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| QDX83_RS19720 (4000945) | 4000945..4001301 | + | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15471.88 Da Isoelectric Point: 8.0949
>T277289 WP_001521903.1 NZ_CP122600:c3996626-3996228 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D8WHS4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |