Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3996228..3996922 Replicon chromosome
Accession NZ_CP122600
Organism Escherichia coli strain ETEC6333

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag QDX83_RS19690 Protein ID WP_001521903.1
Coordinates 3996228..3996626 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag QDX83_RS19695 Protein ID WP_000554755.1
Coordinates 3996629..3996922 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX83_RS19660 (3991362) 3991362..3992819 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
QDX83_RS19665 (3992828) 3992828..3993109 + 282 WP_077881290.1 hypothetical protein -
QDX83_RS19670 (3993126) 3993126..3993635 - 510 WP_063085380.1 metal-dependent hydrolase -
QDX83_RS19675 (3993697) 3993697..3994311 - 615 WP_000602129.1 peptide chain release factor H -
QDX83_RS19680 (3994308) 3994308..3995447 - 1140 WP_063085369.1 RNA ligase RtcB family protein -
QDX83_RS19685 (3995766) 3995766..3996218 - 453 WP_001059858.1 GNAT family N-acetyltransferase -
QDX83_RS19690 (3996228) 3996228..3996626 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QDX83_RS19695 (3996629) 3996629..3996922 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QDX83_RS19700 (3996974) 3996974..3998029 - 1056 WP_001226166.1 DNA polymerase IV -
QDX83_RS19705 (3998100) 3998100..3998885 - 786 WP_074150236.1 putative lateral flagellar export/assembly protein LafU -
QDX83_RS19710 (3998857) 3998857..4000569 + 1713 Protein_3863 flagellar biosynthesis protein FlhA -
QDX83_RS19715 (4000674) 4000674..4000952 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
QDX83_RS19720 (4000945) 4000945..4001301 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T277289 WP_001521903.1 NZ_CP122600:c3996626-3996228 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT277289 WP_000554755.1 NZ_CP122600:c3996922-3996629 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References