Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2687224..2687595 | Replicon | chromosome |
| Accession | NZ_CP122600 | ||
| Organism | Escherichia coli strain ETEC6333 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A839BBC2 |
| Locus tag | QDX83_RS13195 | Protein ID | WP_021500490.1 |
| Coordinates | 2687224..2687418 (+) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2687417..2687595 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX83_RS13175 (2682354) | 2682354..2682524 | + | 171 | WP_065336296.1 | YdaE family protein | - |
| QDX83_RS13180 (2682599) | 2682599..2682874 | + | 276 | WP_001372690.1 | hypothetical protein | - |
| QDX83_RS13185 (2682974) | 2682974..2686096 | + | 3123 | WP_000105090.1 | exodeoxyribonuclease VIII | - |
| QDX83_RS13190 (2686108) | 2686108..2687160 | + | 1053 | WP_001004412.1 | RecT family recombinase | - |
| QDX83_RS13195 (2687224) | 2687224..2687418 | + | 195 | WP_021500490.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| - (2687417) | 2687417..2687595 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2687417) | 2687417..2687595 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2687417) | 2687417..2687595 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2687417) | 2687417..2687595 | - | 179 | NuclAT_1 | - | Antitoxin |
| QDX83_RS13200 (2687411) | 2687411..2687599 | + | 189 | WP_001372676.1 | DUF1187 family protein | - |
| QDX83_RS13205 (2687699) | 2687699..2687914 | + | 216 | WP_000079604.1 | excisionase XisR | - |
| QDX83_RS13210 (2687916) | 2687916..2689151 | + | 1236 | WP_024168543.1 | site-specific integrase | - |
| QDX83_RS13215 (2689203) | 2689203..2690138 | + | 936 | WP_001157382.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| QDX83_RS13220 (2690267) | 2690267..2691640 | - | 1374 | WP_063085924.1 | ATP-dependent RNA helicase DbpA | - |
| QDX83_RS13225 (2691670) | 2691670..2691843 | - | 174 | WP_001296046.1 | protein YnaL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2664741..2689151 | 24410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7046.98 Da Isoelectric Point: 9.2886
>T277282 WP_021500490.1 NZ_CP122600:2687224-2687418 [Escherichia coli]
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT277282 NZ_CP122600:c2687595-2687417 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGCTGGTAGGAGAACCACCTTCCTTTT
CAATAGTGGCGGTGATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGCTGGTAGGAGAACCACCTTCCTTTT
CAATAGTGGCGGTGATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
