Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1120530..1121257 | Replicon | chromosome |
Accession | NZ_CP122600 | ||
Organism | Escherichia coli strain ETEC6333 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0YLE2 |
Locus tag | QDX83_RS05350 | Protein ID | WP_000547555.1 |
Coordinates | 1120530..1120841 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDX83_RS05355 | Protein ID | WP_000126294.1 |
Coordinates | 1120838..1121257 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX83_RS05325 (1116465) | 1116465..1118174 | + | 1710 | WP_063086195.1 | formate hydrogenlyase subunit HycE | - |
QDX83_RS05330 (1118184) | 1118184..1118726 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
QDX83_RS05335 (1118726) | 1118726..1119493 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
QDX83_RS05340 (1119490) | 1119490..1119900 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
QDX83_RS05345 (1119893) | 1119893..1120363 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
QDX83_RS05350 (1120530) | 1120530..1120841 | + | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
QDX83_RS05355 (1120838) | 1120838..1121257 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
QDX83_RS05360 (1121336) | 1121336..1122760 | - | 1425 | WP_063086210.1 | 6-phospho-beta-glucosidase AscB | - |
QDX83_RS05365 (1122769) | 1122769..1124226 | - | 1458 | WP_001107888.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
QDX83_RS05370 (1124486) | 1124486..1125496 | + | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
QDX83_RS05375 (1125645) | 1125645..1126172 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T277273 WP_000547555.1 NZ_CP122600:1120530-1120841 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT277273 WP_000126294.1 NZ_CP122600:1120838-1121257 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|