Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 70475..71186 | Replicon | plasmid unnamed5 |
Accession | NZ_CP122593 | ||
Organism | Escherichia coli strain ETEC6335 |
Toxin (Protein)
Gene name | higB | Uniprot ID | I2UJZ0 |
Locus tag | QDY30_RS26815 | Protein ID | WP_000162415.1 |
Coordinates | 70475..70777 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QDY30_RS26820 | Protein ID | WP_000806445.1 |
Coordinates | 70848..71186 (+) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY30_RS26785 (QDY30_26785) | 65494..66144 | - | 651 | WP_032153356.1 | hypothetical protein | - |
QDY30_RS26790 (QDY30_26790) | 66158..67063 | - | 906 | WP_001258014.1 | recombination-associated protein RdgC | - |
QDY30_RS26795 (QDY30_26795) | 67123..67776 | - | 654 | WP_000828873.1 | hypothetical protein | - |
QDY30_RS26800 (QDY30_26800) | 67773..68753 | - | 981 | WP_000046499.1 | hypothetical protein | - |
QDY30_RS26805 (QDY30_26805) | 68757..69524 | - | 768 | WP_000203290.1 | hypothetical protein | - |
QDY30_RS26810 (QDY30_26810) | 69521..70312 | - | 792 | WP_000532305.1 | hypothetical protein | - |
QDY30_RS26815 (QDY30_26815) | 70475..70777 | + | 303 | WP_000162415.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QDY30_RS26820 (QDY30_26820) | 70848..71186 | + | 339 | WP_000806445.1 | HigA family addiction module antitoxin | Antitoxin |
QDY30_RS26825 (QDY30_26825) | 71243..71428 | + | 186 | Protein_71 | hypothetical protein | - |
QDY30_RS26830 (QDY30_26830) | 71465..72193 | + | 729 | WP_000986754.1 | hypothetical protein | - |
QDY30_RS26835 (QDY30_26835) | 72227..73420 | - | 1194 | WP_001112633.1 | hypothetical protein | - |
QDY30_RS26840 (QDY30_26840) | 73413..73742 | - | 330 | WP_000542383.1 | hypothetical protein | - |
QDY30_RS26845 (QDY30_26845) | 74071..74724 | - | 654 | WP_000410952.1 | hypothetical protein | - |
QDY30_RS26850 (QDY30_26850) | 75071..75892 | + | 822 | WP_001427910.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..95838 | 95838 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11818.56 Da Isoelectric Point: 9.8739
>T277266 WP_000162415.1 NZ_CP122593:70475-70777 [Escherichia coli]
MTKKINIKDFRDAWLDDFFEFSTPHRKIPPDIHMTLSRKLDIINAATTCKDLRSPPGNRYEELSGKLNGYSSVRVNKQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHRKIPPDIHMTLSRKLDIINAATTCKDLRSPPGNRYEELSGKLNGYSSVRVNKQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|