Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-agrB/- |
| Location | 16455..16813 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP122592 | ||
| Organism | Escherichia coli strain ETEC6335 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QDY30_RS25840 | Protein ID | WP_151318007.1 |
| Coordinates | 16712..16813 (+) | Length | 34 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 16455..16603 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY30_RS25800 (11683) | 11683..11889 | + | 207 | WP_000547945.1 | hypothetical protein | - |
| QDY30_RS25805 (11915) | 11915..12445 | + | 531 | WP_032214168.1 | single-stranded DNA-binding protein | - |
| QDY30_RS25810 (12501) | 12501..12734 | + | 234 | WP_000005971.1 | DUF905 domain-containing protein | - |
| QDY30_RS25815 (12798) | 12798..14756 | + | 1959 | WP_282835507.1 | ParB/RepB/Spo0J family partition protein | - |
| QDY30_RS25820 (14811) | 14811..15245 | + | 435 | WP_053897480.1 | conjugation system SOS inhibitor PsiB | - |
| QDY30_RS25825 (15242) | 15242..15961 | + | 720 | WP_042634414.1 | plasmid SOS inhibition protein A | - |
| QDY30_RS25830 (15961) | 15961..16479 | + | 519 | WP_001178554.1 | hypothetical protein | - |
| - (16455) | 16455..16603 | + | 149 | NuclAT_0 | - | Antitoxin |
| - (16455) | 16455..16603 | + | 149 | NuclAT_0 | - | Antitoxin |
| - (16455) | 16455..16603 | + | 149 | NuclAT_0 | - | Antitoxin |
| - (16455) | 16455..16603 | + | 149 | NuclAT_0 | - | Antitoxin |
| QDY30_RS25835 (16669) | 16669..16746 | + | 78 | Protein_23 | DUF5431 family protein | - |
| QDY30_RS25840 (16712) | 16712..16813 | + | 102 | WP_151318007.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QDY30_RS25845 (17188) | 17188..17838 | + | 651 | WP_000993956.1 | IS66-like element accessory protein TnpA | - |
| QDY30_RS25850 (17838) | 17838..18185 | + | 348 | WP_000624618.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDY30_RS25855 (18205) | 18205..19776 | + | 1572 | WP_000381443.1 | IS66 family transposase | - |
| QDY30_RS25860 (19802) | 19802..20122 | - | 321 | Protein_28 | hypothetical protein | - |
| QDY30_RS25865 (20192) | 20192..20398 | + | 207 | WP_042634482.1 | hypothetical protein | - |
| QDY30_RS25870 (20422) | 20422..20718 | + | 297 | WP_021558926.1 | hypothetical protein | - |
| QDY30_RS25875 (20824) | 20824..21645 | + | 822 | WP_042634481.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | hlyC / hlyA / hlyB / hlyB / hlyD / estIa | 1..120805 | 120805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 34 a.a. Molecular weight: 3921.52 Da Isoelectric Point: 7.9707
>T277261 WP_151318007.1 NZ_CP122592:16712-16813 [Escherichia coli]
MIFTYLTRKSLCEIRYRDGDREVAAFMAYESGK
MIFTYLTRKSLCEIRYRDGDREVAAFMAYESGK
Download Length: 102 bp
Antitoxin
Download Length: 149 bp
>AT277261 NZ_CP122592:16455-16603 [Escherichia coli]
CAGGGTGCAGACATATGGGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGT
GTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGCATCCCATATGTCT
CAGGGTGCAGACATATGGGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGT
GTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGCATCCCATATGTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
