Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 15499..15763 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP122589 | ||
| Organism | Escherichia coli strain ETEC6335 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | QDY30_RS24930 | Protein ID | WP_001303307.1 |
| Coordinates | 15611..15763 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 15499..15561 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY30_RS24915 (11601) | 11601..12671 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| QDY30_RS24920 (12690) | 12690..13898 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (14078) | 14078..14135 | - | 58 | NuclAT_1 | - | - |
| - (14078) | 14078..14135 | - | 58 | NuclAT_1 | - | - |
| - (14078) | 14078..14135 | - | 58 | NuclAT_1 | - | - |
| - (14078) | 14078..14135 | - | 58 | NuclAT_1 | - | - |
| QDY30_RS24925 (14205) | 14205..14984 | - | 780 | WP_275450201.1 | protein FinQ | - |
| - (15499) | 15499..15561 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (15499) | 15499..15561 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (15499) | 15499..15561 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (15499) | 15499..15561 | - | 63 | NuclAT_0 | - | Antitoxin |
| QDY30_RS24930 (15611) | 15611..15763 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| QDY30_RS24935 (15835) | 15835..16086 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| QDY30_RS24940 (16281) | 16281..17852 | - | 1572 | WP_000381443.1 | IS66 family transposase | - |
| QDY30_RS24945 (17872) | 17872..18219 | - | 348 | WP_000624618.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDY30_RS24950 (18219) | 18219..18869 | - | 651 | WP_000993956.1 | IS66-like element accessory protein TnpA | - |
| - (19185) | 19185..19236 | - | 52 | NuclAT_2 | - | - |
| - (19185) | 19185..19236 | - | 52 | NuclAT_2 | - | - |
| - (19185) | 19185..19236 | - | 52 | NuclAT_2 | - | - |
| - (19185) | 19185..19236 | - | 52 | NuclAT_2 | - | - |
| QDY30_RS24955 (19916) | 19916..20011 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| QDY30_RS24960 (20076) | 20076..20252 | - | 177 | WP_001054898.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / qacE / ant(3'')-Ia / dfrA1 / tet(A) | - | 1..136050 | 136050 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T277256 WP_001303307.1 NZ_CP122589:15611-15763 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT277256 NZ_CP122589:c15561-15499 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
