Detailed information of TA system TA277248

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2803507..2803727
• Replicon: chromosome
• Accession: NZ_CP122588
• Organism: Escherichia coli strain ETEC6335

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: QDY30_RS13740
• Protein ID: WP_000170963.1
• Coordinates: 2803620..2803727 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2803507..2803573 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QDY30_RS13715	2798785..2800179	-	1395	WP_000086192.1	inverse autotransporter invasin YchO	-
QDY30_RS13720	2800365..2800718	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
QDY30_RS13725	2800762..2801457	-	696	WP_001301489.1	glutathione-specific gamma-glutamylcyclotransferase	-
QDY30_RS13730	2801615..2801845	-	231	WP_001146444.1	putative cation transport regulator ChaB	-
QDY30_RS13735	2802115..2803215	+	1101	WP_000063607.1	sodium-potassium/proton antiporter ChaA	-
-	2803507..2803573	-	67	-	-	Antitoxin
QDY30_RS13740	2803620..2803727	+	108	WP_000170963.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2804040..2804103	-	64	NuclAT_33	-	-
-	2804040..2804103	-	64	NuclAT_33	-	-
-	2804040..2804103	-	64	NuclAT_33	-	-
-	2804040..2804103	-	64	NuclAT_33	-	-
-	2804040..2804103	-	64	NuclAT_35	-	-
-	2804040..2804103	-	64	NuclAT_35	-	-
-	2804040..2804103	-	64	NuclAT_35	-	-
-	2804040..2804103	-	64	NuclAT_35	-	-
-	2804040..2804103	-	64	NuclAT_37	-	-
-	2804040..2804103	-	64	NuclAT_37	-	-
-	2804040..2804103	-	64	NuclAT_37	-	-
-	2804040..2804103	-	64	NuclAT_37	-	-
-	2804040..2804103	-	64	NuclAT_39	-	-
-	2804040..2804103	-	64	NuclAT_39	-	-
-	2804040..2804103	-	64	NuclAT_39	-	-
-	2804040..2804103	-	64	NuclAT_39	-	-
-	2804040..2804103	-	64	NuclAT_41	-	-
-	2804040..2804103	-	64	NuclAT_41	-	-
-	2804040..2804103	-	64	NuclAT_41	-	-
-	2804040..2804103	-	64	NuclAT_41	-	-
-	2804040..2804103	-	64	NuclAT_43	-	-
-	2804040..2804103	-	64	NuclAT_43	-	-
-	2804040..2804103	-	64	NuclAT_43	-	-
-	2804040..2804103	-	64	NuclAT_43	-	-
-	2804042..2804103	-	62	NuclAT_18	-	-
-	2804042..2804103	-	62	NuclAT_18	-	-
-	2804042..2804103	-	62	NuclAT_18	-	-
-	2804042..2804103	-	62	NuclAT_18	-	-
-	2804042..2804103	-	62	NuclAT_20	-	-
-	2804042..2804103	-	62	NuclAT_20	-	-
-	2804042..2804103	-	62	NuclAT_20	-	-
-	2804042..2804103	-	62	NuclAT_20	-	-
-	2804042..2804103	-	62	NuclAT_22	-	-
-	2804042..2804103	-	62	NuclAT_22	-	-
-	2804042..2804103	-	62	NuclAT_22	-	-
-	2804042..2804103	-	62	NuclAT_22	-	-
-	2804042..2804103	-	62	NuclAT_24	-	-
-	2804042..2804103	-	62	NuclAT_24	-	-
-	2804042..2804103	-	62	NuclAT_24	-	-
-	2804042..2804103	-	62	NuclAT_24	-	-
-	2804042..2804103	-	62	NuclAT_29	-	-
-	2804042..2804103	-	62	NuclAT_29	-	-
-	2804042..2804103	-	62	NuclAT_29	-	-
-	2804042..2804103	-	62	NuclAT_29	-	-
-	2804042..2804103	-	62	NuclAT_31	-	-
-	2804042..2804103	-	62	NuclAT_31	-	-
-	2804042..2804103	-	62	NuclAT_31	-	-
-	2804042..2804103	-	62	NuclAT_31	-	-
QDY30_RS13745	2804156..2804263	+	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
QDY30_RS13750	2804411..2805265	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
QDY30_RS13755	2805301..2806110	-	810	WP_001257044.1	invasion regulator SirB1	-
QDY30_RS13760	2806114..2806506	-	393	WP_000200378.1	invasion regulator SirB2	-
QDY30_RS13765	2806503..2807336	-	834	WP_000456466.1	peptide chain release factor N(5)-glutamine methyltransferase	-
QDY30_RS13770	2807336..2808418	-	1083	WP_000804726.1	peptide chain release factor 1	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T277248 WP_000170963.1 NZ_CP122588:2803620-2803727 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 67 bp

>AT277248 NZ_CP122588:c2803573-2803507 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin