Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2803507..2803727 | Replicon | chromosome |
| Accession | NZ_CP122588 | ||
| Organism | Escherichia coli strain ETEC6335 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | QDY30_RS13740 | Protein ID | WP_000170963.1 |
| Coordinates | 2803620..2803727 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2803507..2803573 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY30_RS13715 | 2798785..2800179 | - | 1395 | WP_000086192.1 | inverse autotransporter invasin YchO | - |
| QDY30_RS13720 | 2800365..2800718 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| QDY30_RS13725 | 2800762..2801457 | - | 696 | WP_001301489.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| QDY30_RS13730 | 2801615..2801845 | - | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| QDY30_RS13735 | 2802115..2803215 | + | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2803507..2803573 | - | 67 | - | - | Antitoxin |
| QDY30_RS13740 | 2803620..2803727 | + | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2804040..2804103 | - | 64 | NuclAT_33 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_33 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_33 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_33 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_35 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_35 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_35 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_35 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_37 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_37 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_37 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_37 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_39 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_39 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_39 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_39 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_41 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_41 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_41 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_41 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_43 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_43 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_43 | - | - |
| - | 2804040..2804103 | - | 64 | NuclAT_43 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_18 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_18 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_18 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_18 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_20 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_20 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_20 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_20 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_22 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_22 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_22 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_22 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_24 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_24 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_24 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_24 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_29 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_29 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_29 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_29 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_31 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_31 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_31 | - | - |
| - | 2804042..2804103 | - | 62 | NuclAT_31 | - | - |
| QDY30_RS13745 | 2804156..2804263 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| QDY30_RS13750 | 2804411..2805265 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| QDY30_RS13755 | 2805301..2806110 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| QDY30_RS13760 | 2806114..2806506 | - | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| QDY30_RS13765 | 2806503..2807336 | - | 834 | WP_000456466.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| QDY30_RS13770 | 2807336..2808418 | - | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T277248 WP_000170963.1 NZ_CP122588:2803620-2803727 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT277248 NZ_CP122588:c2803573-2803507 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|